DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and Cgref1

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_620787.2 Gene:Cgref1 / 245918 RGDID:620801 Length:326 Species:Rattus norvegicus


Alignment Length:142 Identity:36/142 - (25%)
Similarity:59/142 - (41%) Gaps:30/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LAVKRGPHHPRGETRRVD----QHLT--------HEEHRIDDDLKDM-GVQANLDDLSEEEKIFY 79
            |.:..|...|:....|:|    |.||        .:..|:.|.||.: .::.:.:.::.|:.:.|
  Rat    59 LLLPLGQAAPKDGVARLDPEAQQQLTTNPFQPGPEQLRRLRDYLKGLEKMEEDPEQMNREQVLLY 123

  Fly    80 MFKAHDNDNNNALDGLE---MIQSAMHHNYDYFKNNERDAYLQNATDELEHFIEAIDKFLLIADD 141
            :|..||.|.|..|||||   |:.:|:.....:|..|.              .|..:|..|...|.
  Rat   124 LFALHDFDQNGQLDGLELLSMLTAALAPGAAHFPINP--------------VILVVDMVLETQDL 174

  Fly   142 NNDGLLHYPEFV 153
            :.|||:...|.:
  Rat   175 DGDGLMTPAELI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 23/80 (29%)
Cgref1NP_620787.2 EF-hand_7 121..188 CDD:290234 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.