DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and F55A11.1

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_505967.1 Gene:F55A11.1 / 179610 WormBaseID:WBGene00010075 Length:186 Species:Caenorhabditis elegans


Alignment Length:132 Identity:39/132 - (29%)
Similarity:60/132 - (45%) Gaps:34/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GETRRVDQHL-THEEHRIDDDLKDMGVQANLDDLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAM 102
            ||..|.:.|: .|.:.::|.       .||   ::.|:..|:.|..||.|.|..|||:|:|::..
 Worm    52 GEQARDEHHIKEHLDGKVDP-------TAN---MTPEQLQFHYFNMHDLDKNGKLDGVELIKAIT 106

  Fly   103 HHNYDYFKNNERDAYLQNATD------------ELEHFIEAIDKFLLIADD--NNDGLLHYPEFV 153
            |    :...|....:.||..:            |||..|::|     :.||  |.||.:.|.||:
 Worm   107 H----FHAENPGPQHTQNNANANHQPPPLPSEVELETMIDSI-----LKDDDFNADGFIDYGEFL 162

  Fly   154 KA 155
            ||
 Worm   163 KA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 30/93 (32%)
F55A11.1NP_505967.1 EF-hand_7 85..164 CDD:290234 27/87 (31%)
EFh 85..164 CDD:238008 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4004
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1601131at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.