DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and TIMP4

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_003247.1 Gene:TIMP4 / 7079 HGNCID:11823 Length:224 Species:Homo sapiens


Alignment Length:216 Identity:48/216 - (22%)
Similarity:96/216 - (44%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLVAVFAFYGRP--ADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRT---------TYK 65
            :||:.:.|....|  .:||||.|:|||.|...:..|::.::  .|:.:.|...         .|:
Human    12 VLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKI--SSEKVVPASADPADTEKMLRYE 74

  Fly    66 VHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLG--KVYIVAGRMPT-----LNICSYYKE 123
            :...:.:|...:.:.:   ..:.||.|.::||:.|:..  |.|::.|::.:     :::|:|.:.
Human    75 IKQIKMFKGFEKVKDV---QYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEP 136

  Fly   124 YTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSP-------FGKCETNYSACM 181
            :..:::.:|...:..|.....|.:|.|:...|  ..:..:.|.|:.       :|....:| .||
Human   137 WEDLSLVQRESLNHHYHLNCGCQITTCYTVPC--TISAPNECLWTDWLLERKLYGYQAQHY-VCM 198

  Fly   182 PHKVQTVNGVISRCRWRRTQL 202
            .|    |:|.   |.|.|..|
Human   199 KH----VDGT---CSWYRGHL 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 41/193 (21%)
TIMP4NP_003247.1 NTR_TIMP 30..213 CDD:239640 43/198 (22%)
Involved in metalloproteinase-binding. /evidence=ECO:0000250|UniProtKB:P16035 30..33 2/2 (100%)