DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp2

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001015760.1 Gene:timp2 / 548477 XenbaseID:XB-GENE-949671 Length:222 Species:Xenopus tropicalis


Alignment Length:193 Identity:43/193 - (22%)
Similarity:81/193 - (41%) Gaps:29/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVHIKRTYKATSEARRMLRDGR--- 86
            ::||||.|.|||..|..||.|::.:.:...: ::.|...|...|||......:.:......:   
 Frog    26 SEACSCSPVHPQQAFCNADIVIRAKAITGKE-VDSGNDVYGNPIKRIQYEIKQIKMFKGPDKDIE 89

  Fly    87 -LSTPQDDAMCGINLDLG--KVYIVAGRMP-----TLNICSYYKEYTRMTITERHGFSGGYAKAT 143
             :.|....|:||:.|::.  |.|::||:..     .:.:|.:...:..::.|::...:..|....
 Frog    90 FIYTAPSSAVCGVTLEIAGKKEYLIAGKADGDGKMHVTLCDFIVPWDSLSPTQKKSLNQRYEMGC 154

  Fly   144 NCTVTPCFGERCFKGRNYADTCKWSPF-------GKCETNYSACMPHKVQTVNGVISRCRWRR 199
            .|.::.|....|.....  |.|.|:.:       |:...:| ||    ::..:|   .|.|.|
 Frog   155 ECKISRCPSIPCLVSSQ--DECLWTDWVTEKNINGRQAKHY-AC----IKRTDG---SCSWYR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 41/188 (22%)
timp2NP_001015760.1 NTR_TIMP 29..211 CDD:239640 42/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9941
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5106
OMA 1 1.010 - - QHG47496
OrthoDB 1 1.010 - - D1122531at2759
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm48364
Panther 1 1.100 - - O PTHR11844
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4784
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.