DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp2b

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_998461.1 Gene:timp2b / 406650 ZFINID:ZDB-GENE-040426-2655 Length:217 Species:Danio rerio


Alignment Length:216 Identity:52/216 - (24%)
Similarity:90/216 - (41%) Gaps:31/216 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYK 65
            |.:.:.:.||.|:|.....|.|    ||||.|.|||..:..||.|::.:|:.:.:.: .|...|.
Zfish     1 MSMSRSVPLLLLVLCGATDFAG----ACSCSPEHPQQAYCNADVVIRAKVVGRKEVV-TGNDAYG 60

  Fly    66 VHIKRTYKATSEARRMLR--DGRLS---TPQDDAMCGINLDL-GK-VYIVAGRMPT-----LNIC 118
            ..|| ..:...:..:|.:  :|.:.   |....|:||:||:. || .|::.|.:.:     :|:|
Zfish    61 YPIK-MIRYDVKQLKMFKGPNGEIDTIFTGPSSALCGVNLESNGKQEYLITGNLNSNGTLRINLC 124

  Fly   119 SYYKEYTRMTITERHGFSGGY-----AKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYS 178
            .|.:.:..:::|::......|     .|...|.:.||       ..:....|.|:.: ..|....
Zfish   125 DYIESWESLSLTQKKSLGPRYQMGCDCKIVQCPIIPC-------SISEPVECLWTDW-VLEGTVQ 181

  Fly   179 ACMPHKVQTVNGVISRCRWRR 199
            .........|....|.|.|.|
Zfish   182 GTQAQHYTCVKRSDSSCAWYR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 43/187 (23%)
timp2bNP_998461.1 TIMP 23..200 CDD:279332 43/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586887
Domainoid 1 1.000 74 1.000 Domainoid score I9074
eggNOG 1 0.900 - - E1_KOG4745
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5261
OMA 1 1.010 - - QHG47496
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm24223
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.