DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp2a

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_878294.1 Gene:timp2a / 359835 ZFINID:ZDB-GENE-030612-1 Length:220 Species:Danio rerio


Alignment Length:216 Identity:55/216 - (25%)
Similarity:98/216 - (45%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVH 67
            :|..:|  ||:::.:|. .|..|:||||.|.|||..|..||.|::.:|:.|.: ::.|...|...
Zfish     4 VRSCIG--TLVVLVLFR-VGEIAEACSCSPVHPQQAFCNADVVIRAKVVGKKE-VDSGNDIYGNP 64

  Fly    68 IKRTYKATSEARRMLRDGR----LSTPQDDAMCGI-NLDLG--KVYIVAGRMPT-----LNICSY 120
            |||......:.:......|    :.|....|:||: |||..  |.|:::|:...     :.:|..
Zfish    65 IKRIQYEIKQIKMFKGPDRHIDVVFTAPSSAVCGVTNLDTNGKKEYLISGKAEANGKMHVTLCDL 129

  Fly   121 YKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPF-------GKCETNYS 178
            ...:..|:.|::...|..|....:|.:|.|....|  ..:..:.|.|:.:       |: ::::.
Zfish   130 IMPWESMSATQKKSLSQRYQMGCDCKITRCATFPC--EISAPEECLWTDWVTEKIIHGR-QSDHY 191

  Fly   179 ACMPHKVQTVNGVISRCRWRR 199
            ||    ::..:|   .|.|.|
Zfish   192 AC----IKRGDG---SCAWYR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 46/189 (24%)
timp2aNP_878294.1 NTR_TIMP 26..209 CDD:239640 47/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586888
Domainoid 1 1.000 74 1.000 Domainoid score I9074
eggNOG 1 0.900 - - E1_KOG4745
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5261
OMA 1 1.010 - - QHG47496
OrthoDB 1 1.010 - - D1122531at2759
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm24223
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.