DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and Timp2

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_068824.1 Gene:Timp2 / 29543 RGDID:61312 Length:220 Species:Rattus norvegicus


Alignment Length:219 Identity:57/219 - (26%)
Similarity:94/219 - (42%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVH 67
            ||..||||.|..:.      ||||||||.|.|||..|..||.|::.:.:.:.: ::.|...|...
  Rat     8 LRLALGLLLLATLL------RPADACSCSPVHPQQAFCNADVVIRAKAVSEKE-VDSGNDIYGNP 65

  Fly    68 IKRTYKATSEARRMLRDGR----LSTPQDDAMCGINLDLG--KVYIVAGRMP-----TLNICSYY 121
            |||......:.:......:    :.|....|:||::||:|  |.|::||:..     .:.:|.:.
  Rat    66 IKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFI 130

  Fly   122 KEYTRMTITERHGFSGGY-----AKATNCTVTPCFGERCFKGRNYADTCKW------SPFGKCET 175
            ..:..::||::...:..|     .|.|.|.:.||:       .:..|.|.|      ......:.
  Rat   131 VPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCY-------ISSPDECLWMDWVTEKSINGHQA 188

  Fly   176 NYSACMPHKVQTVNGVISRCRWRR 199
            .:.||    ::..:|   .|.|.|
  Rat   189 KFFAC----IKRSDG---SCAWYR 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 45/192 (23%)
Timp2NP_068824.1 NTR_TIMP 27..209 CDD:239640 45/194 (23%)
Involved in metalloproteinase-binding. /evidence=ECO:0000250|UniProtKB:P16035 27..30 2/2 (100%)