DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and Timp3

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_037018.2 Gene:Timp3 / 25358 RGDID:3865 Length:211 Species:Rattus norvegicus


Alignment Length:208 Identity:58/208 - (27%)
Similarity:97/208 - (46%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEP--GRTTYKVHIK 69
            |||:.||.......:|  .:||:|.|||||..|..:|.|::.:|:.|....|.  |...|.:...
  Rat     5 LGLVLLLSCWSLGHWG--TEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQM 67

  Fly    70 RTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKV-YIVAGR-----MPTLNICSYYKEYTRMT 128
            :.|:..|   :|.....:.|...:::||:.|::.|. |::.||     |.| .:|::.:.:..:|
  Rat    68 KMYRGFS---KMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYT-GLCNFVERWDHLT 128

  Fly   129 ITERHGFSGGYAKATNCTVTPCFGERCF-KGRNYADTCKW----SPFG--KCETNYSACMPHKVQ 186
            :::|.|.:..|....||.:..|:...|| ..:|   .|.|    |.||  ..::.:.||:..|  
  Rat   129 LSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKN---ECLWTDMLSNFGYPGYQSKHYACIRQK-- 188

  Fly   187 TVNGVISRCRWRR 199
              .|.   |.|.|
  Rat   189 --GGY---CSWYR 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 50/185 (27%)
Timp3NP_037018.2 NTR_TIMP 24..200 CDD:239640 51/187 (27%)
Involved in metalloproteinase-binding. /evidence=ECO:0000250|UniProtKB:P16035 24..27 1/2 (50%)