DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp-1

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_505115.1 Gene:timp-1 / 179199 WormBaseID:WBGene00019476 Length:154 Species:Caenorhabditis elegans


Alignment Length:178 Identity:35/178 - (19%)
Similarity:59/178 - (33%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVAVFAF-----YGRPADACSCMPSHPQTH-FAQADYVVQLRVLRKSDTIEPGRTTYKVHIKRT 71
            :|..||.|     :.:..::||||....:.. :....::.:::|:.|.........:|::...:.
 Worm     1 MLAVVFTFLLCLSFPQSFESCSCMEFQSEKDGYCATSWISKVKVVSKETDGLGLMMSYRLEHLKV 65

  Fly    72 YKATSEARRMLRDGRLSTPQDDAMCG-INLDLGKVYIVAGRMPTLNICSYYKEYTRMTITERHGF 135
            .||   ...|.....::|...::.|| ....:||.||                           |
 Worm    66 IKA---PENMTLPETMNTATQESACGQTKFKVGKQYI---------------------------F 100

  Fly   136 SGGYAKATNCTVTPCFGERCFKGRNYADTCK------WSPF----GKC 173
            .|..|...:..:|.|......|   |.|..|      |..|    |||
 Worm   101 GGSLANNDSLLITFCDWRVPLK---YIDEPKLEMKPTWKKFVDSVGKC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 31/160 (19%)
timp-1NP_505115.1 NTR_TIMP_like 21..138 CDD:239632 27/149 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.