DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and Timp4

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_542370.3 Gene:Timp4 / 110595 MGIID:109125 Length:224 Species:Mus musculus


Alignment Length:217 Identity:52/217 - (23%)
Similarity:102/217 - (47%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGR---------TTYK 65
            |.|.|:|:....|| .:||||.|:|||.||..:..|::.::  .|:.:.|..         ..|:
Mouse    13 LVLRLLALLWPPGR-GEACSCAPAHPQQHFCHSALVIRAKI--SSEKVVPASKDPADTQKLIRYE 74

  Fly    66 VHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLG--KVYIVAGRMPT-----LNICSYYKE 123
            :...:.:|...:|:.:   ..:.||.|.::||:.|:..  |.|::.|::.:     :::|:|.:.
Mouse    75 IKQIKMFKGFEKAKDI---QYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEP 136

  Fly   124 YTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSP-------FGKCETNYSACM 181
            :..:::.:|...:..|.:...|.:|.|:...|  ..:..:.|.|:.       :|....:| .||
Mouse   137 WEDLSLVQRESLNHHYHQNCGCQITTCYAVPC--TISAPNECLWTDWLLERKLYGYQAQHY-VCM 198

  Fly   182 PHKVQTVNGVISRCRWRRTQLY 203
            .|    |:|:   |.|.|..|:
Mouse   199 KH----VDGI---CSWYRGHLH 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 43/193 (22%)
Timp4NP_542370.3 NTR_TIMP 30..211 CDD:239640 44/195 (23%)
Involved in metalloproteinase-binding. /evidence=ECO:0000250|UniProtKB:P16035 30..33 2/2 (100%)