DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp4.2

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001315189.1 Gene:timp4.2 / 108004535 ZFINID:ZDB-GENE-160114-61 Length:187 Species:Danio rerio


Alignment Length:198 Identity:55/198 - (27%)
Similarity:87/198 - (43%) Gaps:33/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDT--IEPGRTTYKVHIKR 70
            |||..:.|.:   ..:..:||||:|.|||..|..:..|::..||.:...  .:|....||:::.:
Zfish    11 GLLFFMCVCL---NEQMLEACSCIPFHPQQEFCYSSAVIKAMVLDEEPIPGQDPEEIKYKINVLQ 72

  Fly    71 TYKATSEARRMLRDG--RLSTPQDDAMCGINLDLGKVYIVAGRMPTLNICSYYKEYTRMTITERH 133
            .:|....|      |  .|.|..|.|||||.|..| :|::|.|...:.:|.....:..::.|.:.
Zfish    73 VFKGAEHA------GIEYLHTASDGAMCGIRLRPG-IYLLAVRGVHVGLCDLVVRWDNLSKTHKK 130

  Fly   134 GFSGGYAKATNCTVTPCFGERCFKGRNYA----DTCKWSPFGKCETNYSACMPHKVQTVNGVISR 194
            ..|.| .:|.:|.|:.||.|.|.:.:.|.    |:.|.       .:.|.||.:..       ..
Zfish   131 ILSLG-QEACDCKVSHCFKEPCDENKCYLTDMFDSVKL-------YSESICMANST-------GS 180

  Fly   195 CRW 197
            |||
Zfish   181 CRW 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 49/178 (28%)
timp4.2NP_001315189.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9074
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5261
OMA 1 1.010 - - QHG47496
OrthoDB 1 1.010 - - D1122531at2759
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm24223
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.