DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and LOC101885062

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_005174719.3 Gene:LOC101885062 / 101885062 -ID:- Length:209 Species:Danio rerio


Alignment Length:200 Identity:50/200 - (25%)
Similarity:86/200 - (43%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKS--DTIEPGRTTYKVHIKRTYKAT 75
            ||..:.......||||||..||||..:..:|.|::.:|:.|.  |....|...|.|...:.||..
Zfish     7 LLFCLLCVMEERADACSCAISHPQDAYCHSDIVIRAKVVGKKLLDDGPFGTLRYTVKQMKMYKGF 71

  Fly    76 SEARRMLRDGRLSTPQDDAMCGINLDLGKV-YIVAGRMPT----LNICSYYKEYTRMTITERHGF 135
            .:.:.:   ..:.|...::|||:..|:.|. |::.||:..    ..:|::.:.:..:::.::.|.
Zfish    72 EKIQHV---QYVYTHDSESMCGVKFDINKYQYLITGRVHDGRLYTGLCNFNRRWEHLSLAQKKGI 133

  Fly   136 SGGYAKATNCTVTPCFGERCFKGRNYADTCKW----SPFG--KCETNYSACMPHKVQTVNGVISR 194
            :..|....:|.:.||....||.  .....|.|    |.||  ..::.:.||:..|.       ..
Zfish   134 NHRYQLGCSCRIKPCHTLPCFV--TSKSECLWTDMLSHFGYPGYQSRHYACIQQKE-------GY 189

  Fly   195 CRWRR 199
            |.|.|
Zfish   190 CSWYR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 45/183 (25%)
LOC101885062XP_005174719.3 NTR_TIMP 22..197 CDD:239640 44/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1122531at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.