DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp4.1

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_005172816.1 Gene:timp4.1 / 101882922 ZFINID:ZDB-GENE-100603-1 Length:229 Species:Danio rerio


Alignment Length:207 Identity:54/207 - (26%)
Similarity:99/207 - (47%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRV----LRKSDTIEP----GRTTY 64
            |||..:.|.:   ..:..:||||..:|||..|..||.|::..:    :|:.:.|.|    |:..|
Zfish    18 GLLFFMCVCL---NQQMLEACSCASAHPQQLFCSADAVLRAEITGEKIRRREDINPMYGLGKIQY 79

  Fly    65 KVHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKVYIVAGRMPT----LNICSYYKEYT 125
            :|.:.:.:|.:...:.:   ..:.|.:..:||||.|:.|: |:::|.|.:    :.:|.:.:.:.
Zfish    80 EVQVIKVFKGSDRIKDL---QHVYTHEMSSMCGIRLNRGQ-YLLSGSMMSEGFFVTLCDFVEHWD 140

  Fly   126 RMTITERHGFSGGYAKATNCTVTPCFGERCF-KGRNYADTCKWS---PFGKCETNYS-ACMPHKV 185
            |:::|::......|....|||::.|..:.|. |.:|......||   ||...|..:. ||:.|. 
Zfish   141 RLSLTQKKNLKYRYQMGCNCTISICTEQPCHPKVKNECILTDWSSLWPFEDGEPVHEYACIRHS- 204

  Fly   186 QTVNGVISRCRW 197
               :|   .|.|
Zfish   205 ---DG---SCSW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 49/187 (26%)
timp4.1XP_005172816.1 NTR_TIMP 35..216 CDD:239640 49/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9074
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5261
OMA 1 1.010 - - QHG47496
OrthoDB 1 1.010 - - D1122531at2759
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm24223
orthoMCL 1 0.900 - - OOG6_112342
Panther 1 1.100 - - LDO PTHR11844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.