DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp-1

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001107329.1 Gene:timp-1 / 100135142 XenbaseID:XB-GENE-5797859 Length:216 Species:Xenopus tropicalis


Alignment Length:215 Identity:56/215 - (26%)
Similarity:99/215 - (46%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LGLLTLLLVAVFA--FYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSD--TIEPGRTTYKVH 67
            |||:.||::...:  .:|     |||...|||:.:..||:|::.|.:.|:.  ..||||.||:|.
 Frog     2 LGLVVLLVLGCLSQGVWG-----CSCGQRHPQSAYCNADFVIRARFIGKTQQKAEEPGRVTYEVK 61

  Fly    68 IKRTYKATSEARRMLRDGR-----LSTPQDDAMCGINLDL---GKVYIVAGRMPTLNI----CSY 120
            ..:.:||.        ||.     ||||..:::||....:   .:.:::.|.:...|:    |::
 Frog    62 TTKIFKAP--------DGMDDIQFLSTPAMESLCGYEHKMSNKSQAFLITGHVMNGNLQIDQCNF 118

  Fly   121 YKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWS--------PFGKCETNY 177
            ...:..:::.:|.||...|.|:.:|::.||:...|  .....:.|.|:        |....::.|
 Frog   119 IVPWASLSVAQRKGFQEVYPKSCSCSIVPCYSGTC--SLESDNQCLWTDVLVNWMEPLNGSQSKY 181

  Fly   178 SACMPHKVQTVNGVISRCRW 197
            .||    |...:|:   |.|
 Frog   182 MAC----VDQGSGL---CSW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 49/192 (26%)
timp-1NP_001107329.1 NTR_like 20..194 CDD:382999 49/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9941
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5106
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm48364
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.