DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timp and timp4.3

DIOPT Version :9

Sequence 1:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001313362.1 Gene:timp4.3 / 100124610 ZFINID:ZDB-GENE-070824-1 Length:198 Species:Danio rerio


Alignment Length:207 Identity:62/207 - (29%)
Similarity:97/207 - (46%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVL--RKSDTIEPGRTTYK--VHI 68
            |||.|:.|.:   .....:||||.|:|||..|..||.|.:.|||  :...::.||...:|  ::|
Zfish    11 GLLFLMCVCL---KEHMLEACSCGPAHPQELFCHADVVFKARVLSMKLIKSMYPGEGYFKFNINI 72

  Fly    69 KRTYKATSEARRMLRDG--RLSTPQDDAMCGINLDLGKVYIVAGRMP-----------TLNICSY 120
            .:.||....|      |  ...||:|:.||||:| ...||:.:|::.           |:::|..
Zfish    73 TKMYKGFEHA------GIKHFFTPEDEGMCGISL-TRSVYLFSGKLVSRHEGHAKKSLTVDLCDI 130

  Fly   121 YKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYSACMPHKV 185
            .|.::|::.||:...| .:.||.||.|:.|:.|.|.:.:.|....    :...|.:.|.||.:..
Zfish   131 VKHWSRLSKTEKKILS-VHRKACNCQVSHCYIEPCDENKCYLRDI----YDPDEGSQSICMANST 190

  Fly   186 QTVNGVISRCRW 197
                   ..|||
Zfish   191 -------GSCRW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TimpNP_731461.1 TIMP 26..197 CDD:279332 55/187 (29%)
timp4.3NP_001313362.1 NTR_like 26..195 CDD:295338 55/187 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9074
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5261
OMA 1 1.010 - - QHG47496
OrthoDB 1 1.010 - - D1122531at2759
OrthoFinder 1 1.000 - - FOG0000998
OrthoInspector 1 1.000 - - otm24223
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.