DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and qsm

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:359 Identity:72/359 - (20%)
Similarity:116/359 - (32%) Gaps:116/359 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDY--CGI--LVSNVSGS---------NRTEERS 118
            ::.|....|....|||..| |.|:|      ||:  ||:  :|:.::|.         ..|..:.
  Fly    60 LKGYPDERCQPQIDGSLAV-FRLSL------SDFYECGVTRMVNQLTGKKVYYHKIIIESTSGKE 117

  Fly   119 IQLAVRVHKTLELADDKFYVITCGKS--------------------GYARDDNAHVVLKFLENDH 163
            | ::|:...|...|.:.....|.|.|                    |:...::..:.....:...
  Fly   118 I-VSVKCITTASPAYNVMMNATTGSSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEITTSLTKRAP 181

  Fly   164 RVRETV--------YGHEYKIRA-----------EFSKPNDTYGLRVGNCFAFDKKNRTQKLTDD 209
            ..|.::        :..:..:::           |.|.|  .|||.|......|....::.|. .
  Fly   182 EPRLSIGVSQDGQKFTRDLTVKSGTPLTMEINLDEDSAP--VYGLGVNYLDVTDTHTSSETLI-F 243

  Fly   210 SGCPYDSKIISRFVPTADGRAAEAVLSSMFKFPEGSEVHLQCDVIQCYGRCV------------- 261
            .||..|..:...| .|.||....|...: ||||:.|.|..:..|..|..:|:             
  Fly   244 KGCTVDPYLFENF-NTIDGDILSAKFKA-FKFPDSSYVQFRATVNVCLDKCLGTQCSNNQVGFGR 306

  Fly   262 ---EIDDCN---DVALAGF-------GKGTN--------------GPRKFGPNEEGSSLAGTT-- 297
               ||...|   :::||.|       |...|              ..::...|..|:.....|  
  Fly   307 RKREISSANKVYEISLAMFLQVQDIEGVNKNEVLQLEEKLRELKLANQRLARNSRGNFAMEQTPA 371

  Fly   298 ----VFVLDPAEARLI---SGNCEDGIRPSWLLW 324
                .||:|..|...:   ||...:|:  |..||
  Fly   372 SAQPAFVVDERELGHLSAGSGAASNGL--SLALW 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 49/240 (20%)
Zona_pellucida <181..256 CDD:278526 23/74 (31%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 51/250 (20%)
Zona_pellucida <200..300 CDD:278526 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.