DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and m

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster


Alignment Length:106 Identity:35/106 - (33%)
Similarity:49/106 - (46%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 RAEFSKPNDTYGLRVGNCFAFDKKNRTQKLTDDSGCPYDSKIISRFVP--TADGRAAEAVLS--S 237
            |.||.       :||.:|.|.|.......|:|:.||....|:||||:.  ..|.||.....:  .
  Fly   210 RGEFD-------MRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFH 267

  Fly   238 MFKFPEGSEVHLQCDVIQCYGRCVEIDDCNDVALAGFGKGT 278
            .||||:...||::|.|..|...|  :|.|.:..:.|.|.|:
  Fly   268 AFKFPDALSVHIKCKVEICRHGC--LDHCQNTGVGGGGGGS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 28/82 (34%)
Zona_pellucida <181..256 CDD:278526 25/78 (32%)
mNP_572747.1 ZP 55..286 CDD:214579 28/82 (34%)
Zona_pellucida <194..287 CDD:278526 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.