DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and CG10005

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster


Alignment Length:144 Identity:30/144 - (20%)
Similarity:53/144 - (36%) Gaps:45/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VTATCKAGTMNIKVKMSSGYTGAVHVRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDYCGILVS 106
            |...|.|.:||:.::....:.|.::.|            ||         :.||.|.  |.:..|
  Fly    56 VNLKCGADSMNVVLETEKPFMGVMYTR------------GS---------FYKQSAP--CFMKPS 97

  Fly   107 NVSGSNRTEERSIQLAVRVHKTLELADDKFYVITCGKSGYARDDNAHVVLKFLENDHRVRETVYG 171
            :..|| ||.|.:.||            |:...|        ||.:.:..:..::||..: .|...
  Fly    98 SSQGS-RTMEMNFQL------------DQCQTI--------RDGDLYTNIVVIQNDPEL-ITPGD 140

  Fly   172 HEYKIRAEFSKPND 185
            ..:.:..:|.:|.:
  Fly   141 SAFSLECDFRQPRN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 29/141 (21%)
Zona_pellucida <181..256 CDD:278526 1/5 (20%)
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.