DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and CG15020

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster


Alignment Length:451 Identity:100/451 - (22%)
Similarity:152/451 - (33%) Gaps:167/451 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HVTATCKAGTMNIKVKMSSGYTGAVHVRDYR-TPGCMAM-GDGSDQVAFSLNLWAKQGASDYCGI 103
            |:.|.|:...|.|::..:..::|.::...|. .|.||.: |.|.|...|.:.|       :.||.
  Fly   219 HIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYYEFYIQL-------NRCGT 276

  Fly   104 LVSNVSGSNRTEERSIQ---------LAVRVHKTLELADDKFYVITCGKSGYARDDNAHVVLKFL 159
            |     |.|..:|.|.:         :.|:.:..:|...|:.:.:||   .|..|....|...||
  Fly   277 L-----GKNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTC---EYGYDFWKTVTFPFL 333

  Fly   160 ENDHRVRETV----------------YGHEYKIRAEFSKPNDTYGLRVG---------------- 192
            :.:......|                ||        ...|..|..:|||                
  Fly   334 DVEVATGNPVVFTLSPPECYMEIQNGYG--------IGGPRVTGPVRVGDPLTLIIYMRSKYDGF 390

  Fly   193 -----NCFAFDKKNRTQKLTDDSGCPYDSKIISRFVPT-ADGRAAEA-VLSSM--FKFPEGSEVH 248
                 :|:|.:..|:..:|.|..|||.|.|:||||..: :|....|. |.:.|  |:|.....::
  Fly   391 DIVVNDCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFTGSPALY 455

  Fly   249 LQCDVIQCYGRC-------------VEIDDCNDVA-------LAGFGKG--TNGPRKFGPNE--- 288
            ::|||..|:|||             .:.|..|..|       |:..|:|  |..|.....:|   
  Fly   456 IECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADGEGLTTESPTANSLSENVN 520

  Fly   289 ---------EGSSLAGTTVFV------LDPAEARLISGNCEDGIRPSWLLWLTITLGVLFLIMLL 338
                     ||.: .|..|:.      |.|.:..|.:..           :..:|.|        
  Fly   521 LFQSLRVLQEGET-DGDDVYAHRQTKPLSPHQTCLKTST-----------FSALTAG-------- 565

  Fly   339 MNIFLCTAMSCSCANTEII-------EKEPSIIEEYDPYRSWHGSQYGSRYSLHGRDAHKG 392
                 |:|:.|....|..|       .||.|:   ||.|                 .||||
  Fly   566 -----CSAVLCVLTVTLFIACSRLKRRKESSL---YDSY-----------------IAHKG 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 61/262 (23%)
Zona_pellucida <181..256 CDD:278526 28/99 (28%)
CG15020NP_647901.1 ZP 223..473 CDD:214579 65/272 (24%)
Zona_pellucida <371..472 CDD:278526 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.