DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and cyr

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001285004.1 Gene:cyr / 31733 FlyBaseID:FBgn0030001 Length:513 Species:Drosophila melanogaster


Alignment Length:446 Identity:83/446 - (18%)
Similarity:147/446 - (32%) Gaps:155/446 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GLWLLPVLLFLAGQVTTQEPPASPSEFAPHVTAT----------------CKAGTMNIKVKMSSG 60
            |:..||..|..|.. ||:.|.:..::.....|.|                |....:.:.:::|..
  Fly    26 GVLHLPQFLCHAAW-TTRTPESFINDTTTTTTTTTTTTTKTMQIQAMQVNCSRELLEMHLELSRP 89

  Fly    61 YTGAVHVRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDYCGILVSNVSGSNRTEERSIQLAVRV 125
            :.|.::.:|:... |.|.|..|.::...:       .:..||:....:      |:.|::..|||
  Fly    90 FRGLLYAKDFPLE-CRARGKDSTRLHLRI-------PTSGCGVRAEPL------EDGSLEYTVRV 140

  Fly   126 ----HKTLELADDKFYVITCGKSGYA--------RDDNAHVVLKFLENDHRV------------- 165
                .:.|..:.|....:.|.....|        |.:..|      :.:.|:             
  Fly   141 MLQKEQKLRQSTDILSSVRCQLPANAMGMPLPVLRQEKGH------DRNARMRALAAAAAVPALG 199

  Fly   166 ---------RETVYGHEYKIRAEFSKPNDT--------------------YGLRVGNCFAFDKKN 201
                     |||   ...:|..|...||.|                    .|:||.:|.|.|...
  Fly   200 ATSSINQQQRET---PRVRIWLELGGPNGTGSVEVGVATTLTVRAIVPGNIGVRVVDCAALDGLG 261

  Fly   202 R-TQKLTDDSGCPYDSKII----SRFVPTADGRAAE----------AVLSSMFKFPEGSEVHLQC 251
            . ||:|.|..|||.|.:::    ::..|..:|.:.:          |.....||||:...:|:.|
  Fly   262 ESTQQLLDARGCPIDEQVMPALHTQHRPAEEGWSKQHEEDLVERTFAATFPAFKFPDRERLHVSC 326

  Fly   252 DVIQCYGRC--------------------VEIDDCNDVALAG---------FGKGTN-GPRKFGP 286
            .|..|.|:|                    ..|:..|.:|:..         :.:..| ....:.|
  Fly   327 GVQLCKGKCPTLNCRLKTPPPALSAEQHLARIEVFNSLAVTAPQIEVDRLRYDRRHNMSGEDYAP 391

  Fly   287 NEEGSSLAGTTVFVLDPAEARLISGNCEDGIRPSWLLWLTITLGVLFLIMLLMNIF 342
            :..|..:.|.....|  :.::|....|              .||::||:.:::.||
  Fly   392 HVRGQVMPGEGTLCL--SISKLAISFC--------------VLGLIFLVAVVVAIF 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 55/295 (19%)
Zona_pellucida <181..256 CDD:278526 27/109 (25%)
cyrNP_001285004.1 ZP 82..344 CDD:214579 56/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.