DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and cutl-29

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_509395.2 Gene:cutl-29 / 181081 WormBaseID:WBGene00017421 Length:390 Species:Caenorhabditis elegans


Alignment Length:413 Identity:86/413 - (20%)
Similarity:147/413 - (35%) Gaps:123/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TCKAGTMNIKVKMSSGYTGAV---HVRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDYCGILVS 106
            ||.:..:.:.:..:..::|.|   :.|.|..  |...|:||:.::.::.|:    .|..|.::.:
 Worm    26 TCTSSNIEVALTFAKSFSGGVLTENPRKYEQ--CRWKGNGSNSMSINIPLF----NSTKCAVVAN 84

  Fly   107 NVSGSNRTEERSIQLAVRVHKTLELADDKFYVITCGKSGYARDD------------NAHVVLKFL 159
            ..||:     .||:|.|.....|.:  |.|..|.. |..||..|            || :.:..:
 Worm    85 ETSGT-----YSIKLLVSPVDGLIV--DGFSAINV-KCIYATQDITLTLPPIFNGTNA-LQITAM 140

  Fly   160 ENDHRV-----------RETVYGH------------EYKIRAEFSKPNDT-YGLRVGNCFAFDKK 200
            .:|:.|           .:.:.||            ..:|..:.:..|.. |...|.:|:|.|..
 Worm   141 NDDNSVVTGSGGSPALTMQILEGHGISGSPVVKAAVGQRITLDIALQNTAIYDFYVHSCYAHDGS 205

  Fly   201 NRTQ---KLTDDSGCPYDSKIISRFV--------PTADGRAAEAVLSSMFKFPEGSEVHLQCDVI 254
            |...   .:.|.:||   ...:||.:        ||.:|.....:....|:|...:.||.:|.|.
 Worm   206 NSPDASINIIDSNGC---GVRLSRAIDVPAMSAQPTPNGPKHVYLHMYGFQFTSNNFVHFECQVK 267

  Fly   255 QCY-----GRCVEIDDCNDVALAGFGKGTNGPRKFGPNEEGSSLAGT----TVFVLDP----AEA 306
            .|.     .:|:...|.....:....:     |:   :|:.|:...|    ||..:.|    :.|
 Worm   268 PCIKSCHREQCIREPDTKIPVIPAHRR-----RR---HEDNSTDVATLRLETVLEISPQSTLSAA 324

  Fly   307 RLISGNCEDGIRPSW-----LLWLTITLGVLFLIMLLMNIFLCTAMSCSCANTEIIEKEPSIIEE 366
            .|:|.  ||..||:.     .|..|.|.           :|:.||:..|..:.            
 Worm   325 ALVSS--EDYARPAHCYSQPALIATCTF-----------VFVITALLVSMVHV------------ 364

  Fly   367 YDPYRSWHGSQYGSRYSLHGRDA 389
              .||.|..|...|  |::..|:
 Worm   365 --VYRRWTKSDKTS--SINDNDS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 55/260 (21%)
Zona_pellucida <181..256 CDD:278526 21/86 (24%)
cutl-29NP_509395.2 Zona_pellucida 26..278 CDD:391783 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014303
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.