DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12814 and cutl-24

DIOPT Version :9

Sequence 1:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001023450.1 Gene:cutl-24 / 176831 WormBaseID:WBGene00021396 Length:601 Species:Caenorhabditis elegans


Alignment Length:278 Identity:61/278 - (21%)
Similarity:92/278 - (33%) Gaps:78/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLPVLLFLAGQVTTQEP--PASPS---------EFAPHVTATCKAGTMNIKVKMSSGYTGAVHVR 68
            :.||:.......|...|  |..|:         .|||....|.|....  |....|.|..|....
 Worm   269 MAPVMFTFPTTTTPLMPLFPIIPNVHFKQGVGVPFAPGTLPTTKVDAS--KWNDPSAYATAPSTV 331

  Fly    69 DYRTP----------GCMAMGDGSDQVAFSLNLWAKQGA--------SDYCGILVSNVSGSNRTE 115
            |..||          ......|.|.::..:..:.|..|.        .|...:|       ..|:
 Worm   332 DSTTPKTYREQPPTADAPFSSDNSKEIHETSTIVASPGVPRPQADQPKDITSVL-------KTTQ 389

  Fly   116 ERSIQLAVRVHKTLEL--ADDKFY--VITCGKSGYARDDNAHVVLKFLENDHRVRETVYGHEYKI 176
            |:.|:..|    |||:  .:..|.  |.|..|.|    ||..:|:|                   
 Worm   390 EQQIEPEV----TLEIQRGEGPFAPPVTTPIKIG----DNISLVVK------------------- 427

  Fly   177 RAEFSKPNDTYGLRVGNCFAFDKKNRTQ-KLTDDSGCPYDSKIISRFVPTADGRAAE-----AVL 235
            ...:....|.:.:.|.:|||.|.|..|: ::.|::||....:..|   |....:.:|     .:|
 Worm   428 AKSYLNETDQFDMFVHSCFATDGKGDTKVQMIDENGCVIRLEFAS---PLHRAKDSENTMFYYLL 489

  Fly   236 SSMFKFPEGSEVHLQCDV 253
            ...||||...:|:..|.:
 Worm   490 IKAFKFPGPDDVYFSCTI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12814NP_001262454.1 ZP 45..256 CDD:214579 52/237 (22%)
Zona_pellucida <181..256 CDD:278526 21/79 (27%)
cutl-24NP_001023450.1 Zona_pellucida 34..>92 CDD:391783
PHA03247 <169..415 CDD:223021 33/158 (21%)
Zona_pellucida <388..516 CDD:391783 37/150 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.