DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and AT1G02030

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_171705.1 Gene:AT1G02030 / 839285 AraportID:AT1G02030 Length:267 Species:Arabidopsis thaliana


Alignment Length:150 Identity:33/150 - (22%)
Similarity:60/150 - (40%) Gaps:35/150 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 EESQVSDFNMETYEIVQHNPQKEPVETKDTVESIESNEDTQEDI-------SREHVTDEEDEISE 324
            |.::.:|..:...|:.:...::||      :.|:.....|:||:       ||:....||:|..|
plant    91 ETARAADIKIGVQELSESCTEQEP------MSSVSDAATTEEDVALSLMLLSRDKWEKEEEESDE 149

  Fly   325 V------PAMYKCNICKKPYKKPKA-------YKRHMEEVHNTVADDLPQL---------ECNQC 367
            .      ...::|..|:|.:|..:|       :|:.:.|.....:|:|.:.         ||..|
plant   150 ERWKKKRNKWFECETCEKVFKSYQALGGHRASHKKKIAETDQLGSDELKKKKKKSTSSHHECPIC 214

  Fly   368 KLCFPTVAQLHAHHRTHVRA 387
            ...|.:...|..|.|:|..|
plant   215 AKVFTSGQALGGHKRSHASA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 10/43 (23%)
C2H2 Zn finger 364..384 CDD:275368 6/19 (32%)
C2H2 Zn finger 395..416 CDD:275368
C2H2 Zn finger 424..444 CDD:275368
C2H2 Zn finger 452..472 CDD:275368
C2H2 Zn finger 479..499 CDD:275368
C2H2 Zn finger 507..527 CDD:275368
zf-H2C2_2 520..544 CDD:290200
C2H2 Zn finger 535..553 CDD:275368
AT1G02030NP_171705.1 zf-C2H2_6 4..28 CDD:404748
zf-C2H2_6 160..185 CDD:404748 6/24 (25%)
zf-C2H2_6 208..231 CDD:404748 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.