DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and ZFP64

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_060667.2 Gene:ZFP64 / 55734 HGNCID:15940 Length:681 Species:Homo sapiens


Alignment Length:390 Identity:96/390 - (24%)
Similarity:150/390 - (38%) Gaps:78/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 VEAVEEE----LETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPV 291
            |:.|.||    .:||..|..:..|.:.:|         :.....|.:...:||...:.|..:.. 
Human    67 VQFVSEETVPATQTQTTTRTITSETQTIT---------VSAPEFVFEHGYQTYLPTESNENQTA- 121

  Fly   292 ETKDTVESIESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAY-----KRHMEEV 351
                ||.|:.:...|::.             :..||..:.|.|....:...||     :||: ::
Human   122 ----TVISLPAKSRTKKP-------------TTPPAQKRLNCCYPGCQFKTAYGMKDMERHL-KI 168

  Fly   352 HNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSGTLKRHIEGIH 416
            |   ..|.|. :|..|..||....:|..|.|.|...||..   |..|:.....|.:|.:|:. ||
Human   169 H---TGDKPH-KCEVCGKCFSRKDKLKTHMRCHTGVKPYK---CKTCDYAAADSSSLNKHLR-IH 225

  Fly   417 NQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFECPVCKRGFKNNARLKIHLDTHSAE-IYECT 480
            :..:|:.|.:|..:....:.|..|...||.:.||:|.:|...||.::.||.|:..||.| .::|.
Human   226 SDERPFKCQICPYASRNSSQLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKPFKCE 290

  Fly   481 VCGLK------LK----------------------TRRTFNKHKLVHSDTRQFKCEVCGSAFKRS 517
            .|.::      ||                      ::.|..||..||......||..|..:....
Human   291 FCNVRCTMKGNLKSHIRIKHSGNNFKCPHCDFLGDSKATLRKHSRVHQSEHPEKCSECSYSCSSK 355

  Fly   518 KTLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAH----PKELAEEEARGVTRSTLLPMLD 578
            ..|:.|..:|...||:|||:|..|....||...|.::.|    ..|..|.:..|...|..:..||
Human   356 AALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMVKTEALERKDTGRQSSRQVAKLD 420

  Fly   579  578
            Human   421  420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 63/229 (28%)
C2H2 Zn finger 364..384 CDD:275368 7/19 (37%)
C2H2 Zn finger 395..416 CDD:275368 5/20 (25%)
C2H2 Zn finger 424..444 CDD:275368 4/19 (21%)
C2H2 Zn finger 452..472 CDD:275368 7/19 (37%)
C2H2 Zn finger 479..499 CDD:275368 7/47 (15%)
C2H2 Zn finger 507..527 CDD:275368 4/19 (21%)
zf-H2C2_2 520..544 CDD:290200 10/23 (43%)
C2H2 Zn finger 535..553 CDD:275368 7/17 (41%)
ZFP64NP_060667.2 COG5048 <151..450 CDD:227381 75/279 (27%)
zf-H2C2_2 161..186 CDD:290200 9/29 (31%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 190..211 CDD:290200 8/23 (35%)
C2H2 Zn finger 205..225 CDD:275368 5/20 (25%)
zf-H2C2_2 217..239 CDD:290200 7/22 (32%)
C2H2 Zn finger 233..253 CDD:275368 4/19 (21%)
C2H2 Zn finger 261..281 CDD:275368 7/19 (37%)
zf-H2C2_2 273..297 CDD:290200 8/23 (35%)
C2H2 Zn finger 289..308 CDD:275368 4/18 (22%)
C2H2 Zn finger 373..391 CDD:275368 7/17 (41%)
zf-C2H2_6 425..450 CDD:290623
C2H2 Zn finger 427..447 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.