DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and zfp91

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_021326898.1 Gene:zfp91 / 555616 ZFINID:ZDB-GENE-090313-11 Length:792 Species:Danio rerio


Alignment Length:483 Identity:102/483 - (21%)
Similarity:175/483 - (36%) Gaps:140/483 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VDESLPQNDEVFISEEQPIVCQTETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQI 196
            |.:|.|:.|..:: |....|.:|.||.:.|.|..|..:.:.|::|  ...|.||:|:...:..:|
Zfish   166 VFKSEPEMDVDYV-EANKAVEKTGTSVEKKEEESMDDDVVEEEEC--PFVDDPKDENYRPQSNRI 227

  Fly   197 SGVEEEILEEDVEEDLAEEEVETVEEEIDTVGEEVEAVEEELETQDATDCLVEEVEHMTEDRYIE 261
            ..|..:.....:.:..::.:......:|...|||..:.:|::..:|                   
Zfish   228 PSVRRQDKHSTMTDSSSDSDEAESSSQIPHEGEETISSDEDVPFRD------------------- 273

  Fly   262 ESQIIEESQVSDFNMETYEIVQHNPQKEPVET-------KDTVESIESNEDTQ-----EDISREH 314
                       |.|.::|:....:..|....|       |.||:...:.::|:     .:.:.|.
Zfish   274 -----------DLNDQSYDPKDFSKSKRRPHTRLKEKKDKPTVQETPTEQETEIKTEGGETTEEQ 327

  Fly   315 VTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQCK-------LCFP 372
            ...|.:|.:|.|.  |....:|..|.|:..||..:          |.::..:|:       |..|
Zfish   328 TRAEVEEGAEPPR--KRGRRRKDDKSPRLPKRRKK----------PPVQYVRCEMEGCGTVLAHP 380

  Fly   373 TVAQLHAHHRTHVRAKPKTDNCCPH--CEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYIT 435
            ...|.|..:: |:..|...   |||  |.:.|.....|.||.:. |...:.|:|:.|.::|....
Zfish   381 RYLQHHIKYQ-HLMKKKYV---CPHPTCGRLFRLQKQLLRHAKH-HTDQRDYICEFCARAFKSSH 440

  Fly   436 GLKDHKLVHTDECPFECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVHS 500
            .|..|:::||.|.|.:|.:|....:..|.|..|:..|.|:.                        
Zfish   441 NLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADA------------------------ 481

  Fly   501 DTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKEL-AEEE 564
             |.||.|.:||..|::..::.|                            ||.::||:.| ||..
Zfish   482 -TYQFSCSICGKKFEKKDSVVA----------------------------HKAKSHPEVLIAEAL 517

  Fly   565 ARGVTRSTLLPMLDELTIASKLLKTPAG 592
            |..               |..|:.||||
Zfish   518 AAN---------------AGALITTPAG 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 44/209 (21%)
C2H2 Zn finger 364..384 CDD:275368 5/26 (19%)
C2H2 Zn finger 395..416 CDD:275368 8/22 (36%)
C2H2 Zn finger 424..444 CDD:275368 5/19 (26%)
C2H2 Zn finger 452..472 CDD:275368 5/19 (26%)
C2H2 Zn finger 479..499 CDD:275368 0/19 (0%)
C2H2 Zn finger 507..527 CDD:275368 5/19 (26%)
zf-H2C2_2 520..544 CDD:290200 1/23 (4%)
C2H2 Zn finger 535..553 CDD:275368 1/17 (6%)
zfp91XP_021326898.1 zf-C2H2_8 368..445 CDD:318181 21/81 (26%)
C2H2 Zn finger 402..421 CDD:275368 5/19 (26%)
C2H2 Zn finger 429..449 CDD:275368 5/19 (26%)
zf-C2H2 456..477 CDD:306579 5/20 (25%)
C2H2 Zn finger 457..477 CDD:275368 5/19 (26%)
C2H2 Zn finger 487..503 CDD:275368 5/43 (12%)
Amelogenin <633..>716 CDD:330537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.