DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and CG4936

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:640 Identity:142/640 - (22%)
Similarity:228/640 - (35%) Gaps:204/640 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDILAE-TQAANRDSTIWHQW--CRLCSKEHPTNQNVFFREAKQNSWASTMAMTIGKYFWVDIK 62
            |.|..|. :.||...||  .:|  ||:|.::........|.:..:..    :...|.:...|.||
  Fly     1 MRDSAAHASPAAAATST--QKWIVCRVCLQQPKEPMASIFNDDSEKD----LTHMIRECGGVPIK 59

  Fly    63 REDELSNFLCSECFTLMDCLIEFSERVRKVQILFSKLQLLQSNNLMDYEKIREDCGVATDGWKHI 127
            :.|...:.:|.:||.::....:|.|..::                 .|..:|:            
  Fly    60 QFDHYPDKICEKCFKVLKMAFKFRETCQR-----------------SYGHLRQ------------ 95

  Fly   128 MLGAVDESLPQNDEVFISEEQPIVCQTETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEE 192
            .:|.|:          :.:..|....:||::|:                         |.||..:
  Fly    96 FVGPVE----------VEQRPPEKKGSETATKL-------------------------EPDVDPD 125

  Fly   193 EMQISGVEEEILEEDVEEDLAEEEVETVEEEIDTVG----EEVE-AVEEELETQDATDCLVEEVE 252
            |.:   .|.|..|||.:.||.|......::..:|.|    :|:| .:..|||.        :.:.
  Fly   126 EAE---QEPEHDEEDEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEK--------DRIV 179

  Fly   253 HMTEDRYIEESQIIEESQVSDFNMETYE---IVQHNPQKE-----------PVETKDTVESIESN 303
            |:..:: :||..||||  |.|. .||||   |.......|           .:|..|.||..:..
  Fly   180 HVKNEQ-VEEDGIIEE--VYDV-YETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLT 240

  Fly   304 EDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQCK 368
            |...||.:...:...|:|.  ||:              |:.:                       
  Fly   241 ESAHEDDAEVDLNSTEEEF--VPS--------------KSVR----------------------- 266

  Fly   369 LCFPTVAQLHAHHRTHVRAKPK------------------TDNCCP-----------------HC 398
                  |.:||.:.|..|..|:                  ||...|                 ..
  Fly   267 ------ASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKS 325

  Fly   399 EKRFTTSGTLKRHIEGI------------HNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFE 451
            ||..:....|.|...||            ..:.| |:||:||..:...:.|.:|..||:...|.|
  Fly   326 EKDISIGEVLARKHSGIKTKGGHKILLGDKKEFK-YICDVCGNMYPSQSRLTEHIKVHSGVKPHE 389

  Fly   452 CPVCKRGFKNNARLKIHLDTHSA-EIYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFK 515
            |.:|...|....:|..|::||:. ..|:|:.|........|.|||..:|::.|.::|:||...|.
  Fly   390 CEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFT 454

  Fly   516 RSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPK--ELAEEEARGV 568
            .:.|||.|.::|||.:|:.|:.||:.|......|:| |..|.:  :.|.|...|:
  Fly   455 YTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH-RVIHERRGQSARESVAGL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071 15/79 (19%)
COG5048 <353..554 CDD:227381 61/248 (25%)
C2H2 Zn finger 364..384 CDD:275368 3/19 (16%)
C2H2 Zn finger 395..416 CDD:275368 7/49 (14%)
C2H2 Zn finger 424..444 CDD:275368 6/19 (32%)
C2H2 Zn finger 452..472 CDD:275368 5/19 (26%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
C2H2 Zn finger 507..527 CDD:275368 8/19 (42%)
zf-H2C2_2 520..544 CDD:290200 11/23 (48%)
C2H2 Zn finger 535..553 CDD:275368 6/17 (35%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 15/93 (16%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 18/60 (30%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 7/22 (32%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 9/22 (41%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.