DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and Prdm13

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster


Alignment Length:311 Identity:60/311 - (19%)
Similarity:98/311 - (31%) Gaps:111/311 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 YKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQ-------CKLCFPTVAQLHAHHRTHVR 386
            |.|::|...::.|...|.|:            .|.|.:       .:|.:...|...:|..|...
  Fly   181 YMCHLCHLTFETPHPLKIHL------------ALGCGRSAMDILWMRLHYALKAAARSHTETQHS 233

  Fly   387 AKPKTDNCC---------PHCEKRF------------------TTSGTLKRHIEGIHNQIKP--- 421
            ..|.|.:..         |....||                  ||:.|...::..:.....|   
  Fly   234 PIPATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLST 298

  Fly   422 ----------------------YVCDLCGKSFNYITGLKDHKLVHTDECPFECPVCKRGFKN--- 461
                                  ::|..|||.::...|||.|...||...|.:|..|.|.|.:   
  Fly   299 NPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSN 363

  Fly   462 -NARLKIHLDTH---SAEIYECTVCGLKLKTRRTFNKHKLVHSDT-RQFKCEVCGSAFKRSKTLK 521
             |..:::||.||   ||.:.:....|..:      :....:..:| ..::|.||..:|.|.:.|:
  Fly   364 LNKHVRLHLQTHPSSSAGVADGGASGADM------DGDVDIEGETDADYQCHVCHKSFPRRRDLQ 422

  Fly   522 AHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKELAEEEARGVTRST 572
            .|:....|               |.:..||           .|:|..:.||
  Fly   423 RHMETRHG---------------GHHSHSH-----------SESRSSSTST 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 50/267 (19%)
C2H2 Zn finger 364..384 CDD:275368 4/26 (15%)
C2H2 Zn finger 395..416 CDD:275368 6/47 (13%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 452..472 CDD:275368 7/23 (30%)
C2H2 Zn finger 479..499 CDD:275368 1/19 (5%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
zf-H2C2_2 520..544 CDD:290200 3/23 (13%)
C2H2 Zn finger 535..553 CDD:275368 3/17 (18%)
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 22/99 (22%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 336..358 CDD:290200 9/21 (43%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-C2H2 406..427 CDD:278523 7/20 (35%)
C2H2 Zn finger 408..427 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.