DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and CG4707

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster


Alignment Length:671 Identity:146/671 - (21%)
Similarity:242/671 - (36%) Gaps:172/671 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LCSECFTLMDCLIEFSERVRKVQILFSKLQLLQSNNLMDYEKIREDCGVATDG----WKHIMLGA 131
            :|.||:..:....||.:||       |.|...:|::... |.| |.||...:.    ...:.|.|
  Fly    49 VCRECWNCVSSFEEFHQRV-------SCLHRQRSSDSKS-EPI-EFCGQTEEAIINPLYSVELDA 104

  Fly   132 VDESL--PQNDEVFISEEQPIVCQTETSSKMKSEI------LMIPNFLVEKQCLQEKQDFPKEED 188
            :.|:.  |...:|.::|.:|:.........:|:||      |.:||           :..|..:.
  Fly   105 LAEAFFAPSEVKVEVNELEPLPKVELLEDPVKTEIRTAPKRLGVPN-----------EGSPHSKR 158

  Fly   189 VIEEEMQISGVEEEILEEDVEEDLAEEEVETVEEEIDTVG-----------------EEVEAVEE 236
            .|:.|:.:....:..|.:.:..|.....|...:......|                 |...:.::
  Fly   159 RIKNELPVDSDSDAPLADFLNSDSKRSSVGPAKNSEANKGRQLRRSARRGRPPKAKPESAPSPKK 223

  Fly   237 ELETQDA---------TDCLVEEVEHMTEDRYIEESQIIEESQVSDFNM------ETY-EI---V 282
            ||:::|.         .:.:..|....|:|.....|:  ...:.||.::      |.| ||   |
  Fly   224 ELDSEDGEENARDNNDMEFVAPEAVLGTDDSSSSSSE--SSGEDSDHSLPDIEPEERYAEIPKRV 286

  Fly   283 QHNPQKEPVETKDTVESIESNEDTQEDISREHV-TDEEDEISEVPAMYK---CNICKKPYKKPKA 343
            ...|:|.....|..|..:..   ::|:|.|..: .||.|||  :...:|   |::|....:....
  Fly   287 VVKPKKYRKREKPLVPPVRL---SREEIERRKLQQDEYDEI--ILQFFKKFPCSLCNLLVQNFAD 346

  Fly   344 YKRHMEEVHN-----------------------TVADDLPQLECNQCKLCFPTVAQLHAHHRTH- 384
            .:||....||                       .|..:.....|:||...|.....|..|.:|| 
  Fly   347 MRRHQRVSHNIESGYIECCGRKFHLRKALAEHVLVHKNPDHFMCSQCGRVFQDSRALEVHEQTHT 411

  Fly   385 ---VRAKPK------TDNC---------------------------CPHCEKRFTTSGTLKRHIE 413
               |:|:||      .:.|                           ||.|.|:..|...||.|:.
  Fly   412 NPEVKAEPKEKRIYQCEKCPKSFTTKAAMEYHDVSKHVPKSEFKYSCPECNKKIPTERKLKEHLR 476

  Fly   414 GIHNQIKPYVCDLCGKSFNYITGL-KDHKLVHTDE-----CPFECPVCKRGFKNNARLKIHLDT- 471
            .:|:.....:||.|||:....|.| |.|:|.|:::     .|.:|.:|....::.:.||.|:.| 
  Fly   477 YMHDPEAAIICDKCGKTLRSQTNLKKHHELEHSEKPRPKPDPVQCEICGTWLRHLSGLKQHMKTV 541

  Fly   472 HS--AEIYECTVCGLKLKTRRTFNKHKLVHSD--TRQFKCEVCGSAFKRSKTLKAHLILHTGIRP 532
            |.  .:.:.|.:|.......|...:| :.|:.  .|:|||.:|..||||.:.|:.|...|||...
  Fly   542 HEPPGDEHRCHICNKTSTNSRALKRH-IYHNHLCERKFKCGMCEKAFKRPQDLREHTSTHTGEVL 605

  Fly   533 YKCNFCGRDFANGSNCRSHKRQAHPKELAEEEARGVTRSTLLPMLDELTIASKLLKTPAGPCKVK 597
            |.|..|...|.:.:|...|:::.|..|...:..:        |:             |....|:.
  Fly   606 YTCPNCPMTFFSNANMYKHRQRLHRAEWEADRKK--------PL-------------PPNIMKIS 649

  Fly   598 GSRPKAAPKDQDNGNESPTKD 618
            .....|..|.|.:|...|..:
  Fly   650 QGATTAMKKRQTSGALFPQSE 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071 8/27 (30%)
COG5048 <353..554 CDD:227381 68/271 (25%)
C2H2 Zn finger 364..384 CDD:275368 6/19 (32%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 10/20 (50%)
C2H2 Zn finger 452..472 CDD:275368 6/20 (30%)
C2H2 Zn finger 479..499 CDD:275368 4/19 (21%)
C2H2 Zn finger 507..527 CDD:275368 8/19 (42%)
zf-H2C2_2 520..544 CDD:290200 9/23 (39%)
C2H2 Zn finger 535..553 CDD:275368 5/17 (29%)
CG4707NP_611944.1 zf-AD 3..73 CDD:285071 9/30 (30%)
C2H2 Zn finger 334..355 CDD:275368 4/20 (20%)
LIM <361..407 CDD:295319 6/45 (13%)
C2H2 Zn finger 365..382 CDD:275368 0/16 (0%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
C2H2 Zn finger 427..443 CDD:275368 1/15 (7%)
C2H2 Zn finger 458..476 CDD:275368 8/17 (47%)
C2H2 Zn finger 487..507 CDD:275368 9/19 (47%)
C2H2 Zn finger 521..540 CDD:275368 5/18 (28%)
C2H2 Zn finger 551..572 CDD:275368 5/21 (24%)
C2H2 Zn finger 580..600 CDD:275368 8/19 (42%)
C2H2 Zn finger 608..629 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.