DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and CG8388

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster


Alignment Length:604 Identity:139/604 - (23%)
Similarity:253/604 - (41%) Gaps:95/604 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CRLCSKE-HPTNQNVFFREAKQNSWASTMAMTIGKYFWVDIKREDELSNFLCSECFTLMDCLIEF 85
            |.||::. .....|:.|...:.:|..  :...|.|:||:.|. :.:.:.::|..|:..:      
  Fly     3 CFLCTQTVDDAAGNIEFASEEADSLG--LRCIIEKHFWLQIP-DSKRAGYVCGPCWEQL------ 58

  Fly    86 SERVRKVQILFSK--LQLLQSNNLMDYEKIREDCG---VATDGWKHIMLGAVDESL--------- 136
                    :||..  |.:.|::..::...::|...   ||:...:||:....|:|:         
  Fly    59 --------LLFHNFYLNVEQAHKALEQTVLKETSPPEVVASALEEHIVKSEHDDSVAAAVKRRRG 115

  Fly   137 -PQNDEVFISEEQPIVCQTETSSKMKSEILMIPNFLVEKQCLQE-KQDFPKEE----DVIEEEMQ 195
             |:.           |.|.:...::||        ::|:..|.| |.:||:.:    ||:|::  
  Fly   116 RPRK-----------VAQQDAREELKS--------VLEQINLNEIKIEFPEADLTIADVLEDQ-- 159

  Fly   196 ISGVEEEILEEDVEEDLAEEEVETVEEEIDTVGEEVEAVEE-----ELETQDATDCLVEEVEHMT 255
               .|::.|.:|.......|:.|.:|::..|:..:|.....     :|..:..|.||.:..:...
  Fly   160 ---EEQDFLPDDCISKEGAEDPEVLEKKPPTLKRKVSGRSRGRRRVQLAERPNTSCLPKIQKSQE 221

  Fly   256 EDRYIEESQIIEESQVSDFNMETY-EIVQHNPQKEPVETKDTVESIESNED-TQEDISREHVTDE 318
            .:.||.|...: :..:.:..||.: |::.|..:    |.|....::..|.. .:..:..:|:...
  Fly   222 FNDYIREHYKV-QCHICNLPMEDFSEMLAHVRR----EHKQRGYAMCCNRKFLKRGVLVDHLRRH 281

  Fly   319 EDEISEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQCKLCFPTVAQLHAHHRT 383
            :|     |..:||:||.:.....::.:.|| .:|. :........|.||...|.:......|..|
  Fly   282 QD-----PETFKCSICGRVMGHRRSLELHM-RMHE-IKSRGRLYRCEQCSKAFYSAVVYERHKLT 339

  Fly   384 HV-RAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHT-- 445
            |: |.:.|..  |.||||.:.:..|:::|::.:|..:...:||:||||......|..|...||  
  Fly   340 HIPREQWKVP--CTHCEKTYPSQYTMQQHVKLVHLNLYAKICDVCGKSIRGREALARHMEEHTGG 402

  Fly   446 DECPFECPVCKRGFKNNARLKIHLD-THSAEIYECTVCGLKLKTRRTFNKH----KLVHSDTRQF 505
            .:...:|.:|.........|..|:. .|:||..:...|...||...:...|    |..|:..|..
  Fly   403 PQAAIKCHLCDSMLTTKYGLARHIKMMHTAENLQPMQCEFCLKICPSLQAHQHHIKYTHNTARSH 467

  Fly   506 KCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKELAEEEARGVTR 570
            :|.:|..||||...||.|:..|||...|.|..|.:.|.:.:|..:|:::.|.||..|...:.:.|
  Fly   468 QCPMCEKAFKRPNELKEHMTTHTGEVLYTCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRLNR 532

  Fly   571 STLLPMLDELTIASKLLKT 589
            |    ...:..||..:.||
  Fly   533 S----RKSDTIIAVSVRKT 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071 15/79 (19%)
COG5048 <353..554 CDD:227381 59/208 (28%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 452..472 CDD:275368 4/20 (20%)
C2H2 Zn finger 479..499 CDD:275368 5/23 (22%)
C2H2 Zn finger 507..527 CDD:275368 9/19 (47%)
zf-H2C2_2 520..544 CDD:290200 10/23 (43%)
C2H2 Zn finger 535..553 CDD:275368 5/17 (29%)
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 12/72 (17%)
C2H2 Zn finger 264..281 CDD:275368 2/16 (13%)
C2H2 Zn finger 289..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..369 CDD:275368 7/18 (39%)
C2H2 Zn finger 440..461 CDD:275368 5/20 (25%)
C2H2 Zn finger 469..489 CDD:275368 9/19 (47%)
C2H2 Zn finger 497..515 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.