DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and fezf-1

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_502594.2 Gene:fezf-1 / 3564888 WormBaseID:WBGene00012639 Length:218 Species:Caenorhabditis elegans


Alignment Length:163 Identity:52/163 - (31%)
Similarity:84/163 - (51%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 CPHCEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFECPVCKRGF 459
            |..|.|:|.....|.||:. :|...:|:||.:|||:|...:.|..||::|||..|.:|..|.:.|
 Worm    54 CEICGKQFNAHYNLTRHMP-VHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCF 117

  Fly   460 KNNARLKIHLDTHSA-EIYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTLKAH 523
            ..::.|..|:..|.. :.:.|.:||........:..|:|.|.||::|.|.:|..||.:|..|..|
 Worm   118 NRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFH 182

  Fly   524 LILHTGIRPYKCNFCGRDFANGSNCRSHKRQAH 556
            :..|...:|:.|:.|.:.|....:.:.|.|:.|
 Worm   183 MFTHEEHKPFTCHVCSKGFCRNFDLKKHLRKMH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 50/159 (31%)
C2H2 Zn finger 364..384 CDD:275368
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 452..472 CDD:275368 5/19 (26%)
C2H2 Zn finger 479..499 CDD:275368 5/19 (26%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
zf-H2C2_2 520..544 CDD:290200 7/23 (30%)
C2H2 Zn finger 535..553 CDD:275368 4/17 (24%)
fezf-1NP_502594.2 COG5048 <13..212 CDD:227381 50/158 (32%)
DUF3449 <50..>70 CDD:288759 5/15 (33%)
C2H2 Zn finger 54..74 CDD:275368 7/20 (35%)
zf-H2C2_2 66..91 CDD:290200 11/25 (44%)
C2H2 Zn finger 82..102 CDD:275368 8/19 (42%)
C2H2 Zn finger 110..130 CDD:275368 5/19 (26%)
C2H2 Zn finger 138..158 CDD:275368 5/19 (26%)
C2H2 Zn finger 166..186 CDD:275368 7/19 (37%)
C2H2 Zn finger 194..212 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.