DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and CG9932

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster


Alignment Length:425 Identity:72/425 - (16%)
Similarity:117/425 - (27%) Gaps:150/425 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 HMTEDR-----YIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDTVESIESNEDTQEDISR 312
            |||.:.     ..:....:.|..|..|.::  :::|.  |::.......|.|::..:..|.....
  Fly    41 HMTSNSTSNTPVAQAGSSLLERHVERFRLQ--QLLQQ--QRQAAAVVAVVNSVQQQQQQQPQQVG 101

  Fly   313 EHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQCKLCF------ 371
            ....:|.....::...|.||.|....:.|:.:..|:.:||.      .::..|:||||.      
  Fly   102 MDAKEEGLPQCKIKRNYSCNHCAYFTQNPRYHLTHLRDVHG------EKIVINKCKLCLYASRHF 160

  Fly   372 ----------------------------------------------------------PTVAQL- 377
                                                                      ||:.|: 
  Fly   161 QKLVRHMKMVHGCTDGIPSGHGQARGKRGMSREARKRRLEESVGVMGGQSLTVTVPDVPTLEQVK 225

  Fly   378 ----------------------HAHHRTHVR-------------------------AKPKTDNCC 395
                                  ....|...|                         |:|.|.:  
  Fly   226 RELLLQEEKLQRDIQAFNQRQREEQQREQQRELELVATSAYERQMQVLRDYERQSPAEPPTPS-- 288

  Fly   396 PHCEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLV-HTDECPFECPVCKRGF 459
                   .|||:......|...|.:...|..|..:..|.|.|:.|:|. |.....|.|..|....
  Fly   289 -------PTSGSATPPSNGEEPQNRLLKCSACEFTTLYRTQLRAHELAEHGKTKFFRCDKCSYVT 346

  Fly   460 KNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTLKAHL 524
            ...||...|:..||..:.:|..|..:...:...::|...|.....|||..|.......::|..|.
  Fly   347 HIKARFSKHVKYHSMPMIKCVTCDFRTPYKWNLDRHMKNHGGAGAFKCAACDFTADIKQSLTVHE 411

  Fly   525 ILH--------TGIRPYKCNFCG-----RDFANGS 546
            :.|        ..|.|.:.|..|     .||.:.|
  Fly   412 MNHHVPPVGNAGSIWPRRQNKVGASEMCEDFLSDS 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 52/320 (16%)
C2H2 Zn finger 364..384 CDD:275368 9/106 (8%)
C2H2 Zn finger 395..416 CDD:275368 4/20 (20%)
C2H2 Zn finger 424..444 CDD:275368 7/20 (35%)
C2H2 Zn finger 452..472 CDD:275368 5/19 (26%)
C2H2 Zn finger 479..499 CDD:275368 3/19 (16%)
C2H2 Zn finger 507..527 CDD:275368 4/19 (21%)
zf-H2C2_2 520..544 CDD:290200 9/36 (25%)
C2H2 Zn finger 535..553 CDD:275368 5/17 (29%)
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 5/19 (26%)
C2H2 Zn finger 366..386 CDD:275368 3/19 (16%)
C2H2 Zn finger 394..414 CDD:275368 4/19 (21%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.