DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and CG10959

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:482 Identity:125/482 - (25%)
Similarity:200/482 - (41%) Gaps:100/482 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 HIMLGAVDESLPQNDEVFISEEQ---PIVCQTETSSKMKSEILM--IPNFLVEKQ---------- 175
            ::.|.|..:..|:..|:|...|.   .:||..........|...  |.|...:||          
  Fly    11 YVRLHAQQQLRPKCGEIFYEPEANRFQLVCLLCDMKHFGFEDFARHIRNVHFDKQGRPLTKTVTG 75

  Fly   176 ---CLQEKQDFPKEEDVIEEEMQISGVEEEIL--------EEDVEEDLAEEEVETVEEEIDTVGE 229
               ..:|:|:|   :.|..|.:.:...::|.|        |||.|::|..|:.|.....|..:|.
  Fly    76 LGRLAREEQEF---QGVSAEPLAVDSFKKEYLPNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGG 137

  Fly   230 EVEAVEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETK 294
            :....||.::|       :.:.:|.:....:.|...:|                           
  Fly   138 KQSVDEETIDT-------MWQPDHDSSSASVNEGCALE--------------------------- 168

  Fly   295 DTVESIESNEDTQEDISREHVTDEEDEIS-----EVPAMYKCNICKKPYKKPKAYKRHMEEVHNT 354
             .:..:|:.:|.|.|      .|.|:..|     ..|..|.|..|.:.|...|....|::..|  
  Fly   169 -ALLGVENPQDYQPD------EDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSH-- 224

  Fly   355 VADDLPQ-LECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHNQ 418
               ..|| .:|..||..|.....|..|.|     |..|:..|..|:|.|.:|.:|.||::| |:.
  Fly   225 ---PFPQAFKCVDCKATFDVDRALAQHRR-----KEHTEFACQLCDKVFKSSRSLLRHVQG-HSG 280

  Fly   419 IKPYVC--DLCGKSFNYITGLKDHKLVHTDECPFECPVCKRGFKNNAR--LKIHLDTHSAE-IYE 478
            .:.:.|  :.|||||.....|..|:.||::|..:.|.:|  |:::..|  |.:|..||:.| .::
  Fly   281 ARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELC--GYRSRYREALIVHRRTHTGEKPFQ 343

  Fly   479 CTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFA 543
            |..|..:..::...|:|:.:||..:.:||:.|.|||.|.|.|..|..||.||:.:||..||..:|
  Fly   344 CQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYA 408

  Fly   544 N----GSNCRSHKRQA--HPKELAEEE 564
            .    .::.|:||.||  :..|.||.|
  Fly   409 QAAGLSAHMRAHKLQASVNATEGAEAE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 69/210 (33%)
C2H2 Zn finger 364..384 CDD:275368 7/19 (37%)
C2H2 Zn finger 395..416 CDD:275368 9/20 (45%)
C2H2 Zn finger 424..444 CDD:275368 8/21 (38%)
C2H2 Zn finger 452..472 CDD:275368 6/21 (29%)
C2H2 Zn finger 479..499 CDD:275368 4/19 (21%)
C2H2 Zn finger 507..527 CDD:275368 9/19 (47%)
zf-H2C2_2 520..544 CDD:290200 10/23 (43%)
C2H2 Zn finger 535..553 CDD:275368 6/21 (29%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 8/25 (32%)
COG5048 <258..416 CDD:227381 55/160 (34%)
C2H2 Zn finger 258..278 CDD:275368 9/20 (45%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 6/21 (29%)
zf-H2C2_2 328..353 CDD:290200 7/24 (29%)
C2H2 Zn finger 344..364 CDD:275368 4/19 (21%)
zf-H2C2_2 357..381 CDD:290200 10/23 (43%)
C2H2 Zn finger 372..392 CDD:275368 9/19 (47%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.