DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and Zfp324

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_848847.3 Gene:Zfp324 / 243834 MGIID:2444641 Length:583 Species:Mus musculus


Alignment Length:356 Identity:103/356 - (28%)
Similarity:153/356 - (42%) Gaps:44/356 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 QHNPQKE--PVETKDTVESIESNEDTQ-------EDISREHVTDEE--DEISEV----PAM---- 328
            |..|:.:  |..|..::..:...|:.:       |.....:||:..  ||:.|.    |.:    
Mouse   224 QRKPEMQLTPGRTFQSIPDLHGAEEGRGMSEAWHESQGDPNVTEARIWDELGEALQAGPGLLSGD 288

  Fly   329 --YKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKT 391
              ::|..|.|.:.|.....:|:    .|...:.| .||.||...|...:.|..|.|.|   ..:|
Mouse   289 KPFECRACNKVFVKSSDLLKHL----RTHTGERP-YECAQCGKAFSQTSHLTQHQRIH---SGET 345

  Fly   392 DNCCPHCEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFECPVCK 456
            ...|..|.|.|..|.:|.|| :.||...|.:.|:.|||:|::.:.|..|..:|....|:.|..|.
Mouse   346 PYVCMVCSKAFRHSSSLVRH-QRIHTVEKSFHCNECGKAFSHGSNLSQHLKIHAGGRPYACAQCG 409

  Fly   457 RGFKNNARLKIHLDTHSAE-IYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTL 520
            |.|..|:.|..|..||:.| .|.|::||.......:..||:.||:..:.|.|..||.||..|..|
Mouse   410 RRFCRNSHLIQHERTHTGEKPYACSLCGAAFSQGSSLFKHQRVHTGEKPFSCPHCGRAFSHSSNL 474

  Fly   521 KAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKE---LAEEEARGVTRSTLLPMLDELTI 582
            ..|.:||||.||::|..||:.||.|:...||:| .|..|   :..:..|.......|.....:..
Mouse   475 TQHQLLHTGERPFRCGDCGKAFAKGAVLLSHRR-IHTGEKPFVCTQCGRAFRERPALFHHQRIHT 538

  Fly   583 ASKLLKTPAGP---------CKVKGSRPKAA 604
            ..|.|:.|.|.         ..:.|:.|||:
Mouse   539 GEKALRRPRGSTHPQARSLGVSLDGAPPKAS 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 73/201 (36%)
C2H2 Zn finger 364..384 CDD:275368 7/19 (37%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 7/19 (37%)
C2H2 Zn finger 452..472 CDD:275368 7/19 (37%)
C2H2 Zn finger 479..499 CDD:275368 5/19 (26%)
C2H2 Zn finger 507..527 CDD:275368 8/19 (42%)
zf-H2C2_2 520..544 CDD:290200 12/23 (52%)
C2H2 Zn finger 535..553 CDD:275368 8/17 (47%)
Zfp324NP_848847.3 KRAB 31..91 CDD:214630
KRAB 31..70 CDD:279668
zf-C2H2 291..313 CDD:278523 5/25 (20%)
C2H2 Zn finger 293..313 CDD:275368 5/23 (22%)
COG5048 <297..497 CDD:227381 71/208 (34%)
zf-H2C2_2 305..330 CDD:290200 8/29 (28%)
C2H2 Zn finger 321..341 CDD:275368 7/19 (37%)
zf-H2C2_2 333..358 CDD:290200 9/27 (33%)
C2H2 Zn finger 349..369 CDD:275368 8/20 (40%)
zf-H2C2_2 361..386 CDD:290200 11/25 (44%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
zf-C2H2 403..425 CDD:278523 7/21 (33%)
C2H2 Zn finger 405..425 CDD:275368 7/19 (37%)
zf-H2C2_2 417..442 CDD:290200 9/24 (38%)
C2H2 Zn finger 433..453 CDD:275368 5/19 (26%)
zf-H2C2_2 445..470 CDD:290200 10/24 (42%)
C2H2 Zn finger 461..481 CDD:275368 8/19 (42%)
zf-H2C2_2 473..497 CDD:290200 11/23 (48%)
C2H2 Zn finger 489..509 CDD:275368 9/20 (45%)
zf-H2C2_2 502..524 CDD:290200 6/22 (27%)
C2H2 Zn finger 517..537 CDD:275368 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.