Sequence 1: | NP_649983.2 | Gene: | CG6254 / 41244 | FlyBaseID: | FBgn0037794 | Length: | 634 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494634.1 | Gene: | sdz-12 / 184388 | WormBaseID: | WBGene00017406 | Length: | 330 | Species: | Caenorhabditis elegans |
Alignment Length: | 324 | Identity: | 67/324 - (20%) |
---|---|---|---|
Similarity: | 112/324 - (34%) | Gaps: | 93/324 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 SIESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEEV-----HNTVADD 358
Fly 359 LPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHNQIKP-- 421
Fly 422 -YVCDL--CGKSFNYITGLKDHKLVH-----TDECPFECPVCKRGFKNNARLKIH---------- 468
Fly 469 ----LDTHSAEIYECTV---------------------CGLKLKTRRTF------NKHKLVHSD- 501
Fly 502 ---------------------TRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFAN 544 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6254 | NP_649983.2 | zf-AD | 21..99 | CDD:285071 | |
COG5048 | <353..554 | CDD:227381 | 55/265 (21%) | ||
C2H2 Zn finger | 364..384 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 395..416 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 424..444 | CDD:275368 | 5/21 (24%) | ||
C2H2 Zn finger | 452..472 | CDD:275368 | 5/33 (15%) | ||
C2H2 Zn finger | 479..499 | CDD:275368 | 6/46 (13%) | ||
C2H2 Zn finger | 507..527 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 520..544 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 535..553 | CDD:275368 | 4/10 (40%) | ||
sdz-12 | NP_494634.1 | SFP1 | <25..86 | CDD:227516 | 15/65 (23%) |
C2H2 Zn finger | 29..48 | CDD:275368 | 6/18 (33%) | ||
COG5236 | <32..>197 | CDD:227561 | 39/174 (22%) | ||
C2H2 Zn finger | 65..85 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 93..113 | CDD:275368 | 7/22 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |