DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and M03D4.4

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:254 Identity:68/254 - (26%)
Similarity:101/254 - (39%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 QKEPVETKDTVESIESNEDTQEDISREHV-----TDEEDEISEVPAMYKCNICKKPYKKPKAYKR 346
            |:...|..:|||..:..||..||.|.|..     .::.|.:|:..:.........|.:|..:.::
 Worm    21 QRHEREEHETVEQGDQEEDRMEDDSDELAMIKIKIEDSDFLSDTDSSQLSMNPTTPSEKSSSGEK 85

  Fly   347 HMEEVHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSGTLKRH 411
                         .:.||..|...|....:|..|.|.|...:|   :.|..|.|.|.|...||:|
 Worm    86 -------------GRYECEDCHEMFAVKRELATHMRIHSGEQP---HSCTQCGKEFGTRQLLKKH 134

  Fly   412 IEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFECPVCKRGFKNNARLKIHLDTHSAEI 476
            ... |...:.:||..|.|:|.....|..|.::|:...|.|||.|.:.|.....|..|:..|....
 Worm   135 WMW-HTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIHQERG 198

  Fly   477 YECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRS---KTLKAHLILHTGIRP 532
            :.|..||      |:|.|..::  |....||:...|:..||   .|:||.|.....|:|
 Worm   199 FSCQQCG------RSFLKQVML--DEHHLKCKGKPSSPIRSLLTPTMKAGLESAISIKP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 53/183 (29%)
C2H2 Zn finger 364..384 CDD:275368 6/19 (32%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 6/19 (32%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
C2H2 Zn finger 507..527 CDD:275368 8/22 (36%)
zf-H2C2_2 520..544 CDD:290200 5/13 (38%)
C2H2 Zn finger 535..553 CDD:275368
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 6/19 (32%)
zf-H2C2_2 102..127 CDD:290200 9/27 (33%)
C2H2 Zn finger 118..138 CDD:275368 8/20 (40%)
C2H2 Zn finger 146..166 CDD:275368 6/19 (32%)
zf-H2C2_2 158..181 CDD:290200 8/22 (36%)
zf-C2H2 172..194 CDD:278523 7/21 (33%)
C2H2 Zn finger 174..194 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.