DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and F58G1.2

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001254358.1 Gene:F58G1.2 / 174931 WormBaseID:WBGene00010264 Length:500 Species:Caenorhabditis elegans


Alignment Length:471 Identity:100/471 - (21%)
Similarity:169/471 - (35%) Gaps:129/471 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KQCLQEKQDFPKEEDVI-----EEEMQISGVEEEILEEDVEEDLAEEEVETVEEEIDTVGEEVEA 233
            :.|..|     ||:.:|     ::..||..::|..|:|.:::       |||.|..|:...:|..
 Worm    22 RDCQDE-----KEQQIIASFNAQDAQQIRRIQEHFLQECMKK-------ETVAEANDSGRNDVCC 74

  Fly   234 VEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDTVE 298
            ..::|..      :.|.:..:.....|.:.:||...             ...|.|:..|.:..:.
 Worm    75 PRKKLTG------VGELLASLRNPPKIHKERIILGG-------------DGRPIKKLRENRAALN 120

  Fly   299 SIESNEDTQEDISREHVTDE-EDEISEVPA---------------MYKCNICKKPYKKPKAYKRH 347
            .|:.:.:..:.|.|:...|. ..:::.|||               |::|.:||..:.:....:||
 Worm   121 FIDPSAELDKCIVRQKQQDFCAPDLNMVPASSLSIDEIRNAVRKSMFRCKVCKNRFGEMSLLERH 185

  Fly   348 MEEVH-----------NTVADDLPQLECNQCKL-------CFPTVAQLHA--------------- 379
            :.:.|           ..:||.:.:||..:.::       ..|..:::.|               
 Worm   186 LRDSHPKAYIAFLENQREMADYMGELERERNRIEELVSGGFIPPESEIEATSNNLEVDSIPLPGE 250

  Fly   380 HHRTHV----------------RAK----PKTDNCCPHCEKRFTTSGTLKRHIEGIHNQIKPYV- 423
            :.:.|:                |.|    .|....||.|:|||....:...|:...|.:...:| 
 Worm   251 NSQGHIPRLNRYGGLMYPMDALRKKFPYLKKRSPQCPFCDKRFRNDISFNNHLTKKHPECAEFVQ 315

  Fly   424 CDLCGKSFNYITGLKDHKLVHTDEC--PFECPVCK--RGFKNNARL-----KIHLDTHSAEIYEC 479
            |..|.|.......|..|      :|  .:.|..|:  |...|..||     |.|...||.  :.|
 Worm   316 CLHCFKCLPSAADLPTH------DCDLTYLCLDCRPIRNMCNGYRLFRHRTKFHRGYHSG--FRC 372

  Fly   480 TVCGLKLKTRRTFNKH-KLVHSDTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFA 543
            ..|..|..|.|...|| |:.|..:|.|:|..|...|.....:..|..:||||..::|..|  ||.
 Worm   373 PDCNQKFLTPRKLRKHRKMAHVFSRTFQCHFCEEFFISDTAVTIHERVHTGILKFECTVC--DFR 435

  Fly   544 NGSNCRSHKRQAHPKE 559
            ..   |..:.:.|.||
 Worm   436 AS---RYLQMEEHTKE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 59/253 (23%)
C2H2 Zn finger 364..384 CDD:275368 2/41 (5%)
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 5/19 (26%)
C2H2 Zn finger 452..472 CDD:275368 8/26 (31%)
C2H2 Zn finger 479..499 CDD:275368 8/20 (40%)
C2H2 Zn finger 507..527 CDD:275368 4/19 (21%)
zf-H2C2_2 520..544 CDD:290200 9/23 (39%)
C2H2 Zn finger 535..553 CDD:275368 5/17 (29%)
F58G1.2NP_001254358.1 bZIP <186..222 CDD:304365 5/35 (14%)
C2H2 Zn finger 372..393 CDD:275368 8/20 (40%)
C2H2 Zn finger 401..421 CDD:275368 4/19 (21%)
C2H2 Zn finger 429..449 CDD:275368 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.