DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6254 and Zfp91

DIOPT Version :9

Sequence 1:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_443735.2 Gene:Zfp91 / 109910 MGIID:104854 Length:572 Species:Mus musculus


Alignment Length:523 Identity:111/523 - (21%)
Similarity:188/523 - (35%) Gaps:131/523 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QPIVCQ--TETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQISGVEEEILEEDVEE 210
            ||...:  :....|....:..|.....:|...:||:|    :.|:.:|:.|:...    ......
Mouse    98 QPAAAKPPSPAQGKKSPRLQCIEKLTTDKDPKEEKED----DSVLPQEVSITTTR----ASRSWR 154

  Fly   211 DLAEEEVETVEEEIDTVGEEVEAVEEEL--ETQDATDCLVEEV--EHMT-------EDRYIEESQ 264
            ..:...:..:.:..:|.....:....:|  :|:..||.|..:|  ||.:       |:...||..
Mouse   155 SSSRTSISRLRDSENTRSSRSKTGSLQLVCKTEPITDQLDYDVPEEHQSPGGISSDEEEEEEEEM 219

  Fly   265 IIEESQV---SDFNMETY----EIVQHNPQKEPVETKDTVESIESNEDTQEDISREHVTDEEDEI 322
            :|.|.::   .|...|||    |.....|:::..:.|:..|..|...:.:.::..|.....||| 
Mouse   220 LISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDE- 283

  Fly   323 SEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLECNQCKL--CFPTVAQLHAHHRTHV 385
             |.|.  |....:|..|.|:..||..:          |.::..:|::  |...:|        |.
Mouse   284 -EPPR--KRGRRRKDDKSPRLPKRRKK----------PPIQYVRCEMEGCGTVLA--------HP 327

  Fly   386 RAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHNQIKPYVC--DLCGKSFNYITGLKDHKLVHTDEC 448
            |                    .|:.||:..|...|.|||  ..||:.|.....|..|...|||:.
Mouse   328 R--------------------YLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQR 372

  Fly   449 PFECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSA 513
            .:.|..|.|.||::..|.:                           |:::|:..:..:||:||..
Mouse   373 DYICEYCARAFKSSHNLAV---------------------------HRMIHTGEKPLQCEICGFT 410

  Fly   514 FKRSKTLKAHLILH--TGIRPYKCNFCGRDFANGSNCRSHKRQAHPKELAEE----EARGVTRST 572
            .::..:|..|:..|  .....:.||.||:.|....:..:||.::||:.|..|    .|..:..||
Mouse   411 CRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITST 475

  Fly   573 -----------------LLPMLDELTIASKLLKTPAGPCKVKGSRPKAAPKDQDNGNESPTKDTD 620
                             .||:|.|     .|..:.||.|.:  ...:...|...:|.|..:...|
Mouse   476 DILGTNPEPLTQPADGQGLPLLPE-----PLGNSTAGECLL--LEAEGMSKSYCSGTERVSLMAD 533

  Fly   621 GAI 623
            |.|
Mouse   534 GKI 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 44/206 (21%)
C2H2 Zn finger 364..384 CDD:275368 3/21 (14%)
C2H2 Zn finger 395..416 CDD:275368 3/20 (15%)
C2H2 Zn finger 424..444 CDD:275368 6/21 (29%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
C2H2 Zn finger 479..499 CDD:275368 1/19 (5%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
zf-H2C2_2 520..544 CDD:290200 8/25 (32%)
C2H2 Zn finger 535..553 CDD:275368 6/17 (35%)
Zfp91NP_443735.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308 46/231 (20%)
zf-C2H2_8 315..392 CDD:292531 27/131 (21%)
Interaction with MAP3K14/NIK. /evidence=ECO:0000250 340..370 10/29 (34%)
C2H2 Zn finger 349..368 CDD:275368 5/18 (28%)
C2H2 Zn finger 376..396 CDD:275368 7/46 (15%)
zf-H2C2_2 388..413 CDD:290200 7/51 (14%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..450 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.