DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and ASPGA1

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_196427.1 Gene:ASPGA1 / 830704 AraportID:AT5G08100 Length:315 Species:Arabidopsis thaliana


Alignment Length:133 Identity:34/133 - (25%)
Similarity:54/133 - (40%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 KTGLPKLNVRALPIDARIIYNHKTFKKGKKGKKSTLTGDPNDERAKFRLWNRTKRNLDASGYR-- 192
            |:|.|.|:|..|.:  |.:.||..|   ..||.|.||.....|.....:..:|||....||..  
plant    43 KSGKPPLDVAELVV--RELENHPDF---NAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTV 102

  Fly   193 -SHGGASESEGEQSLHLQWSMRARKSLKRHMPLKHLDKHSRDSKGSMSCHSLRP----RVKQLHN 252
             :....:....|::.|:..:..|.::..|...::.:|          |.|.:.|    |:||...
plant   103 VNPISLARLVMEKTPHIYLAFDAAEAFARAHGVETVD----------SSHFITPENIARLKQAKE 157

  Fly   253 FDR 255
            |:|
plant   158 FNR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
ASPGA1NP_196427.1 PLN02689 1..313 CDD:215372 34/133 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.