DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and ASPGB1

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_566536.1 Gene:ASPGB1 / 820860 AraportID:AT3G16150 Length:325 Species:Arabidopsis thaliana


Alignment Length:171 Identity:31/171 - (18%)
Similarity:67/171 - (39%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 FGVSTRTGCQVD-DILAKEWKEKEQGETFGWMQGSAAMKRQHENLTHIIETMLK----DHFGESS 532
            :.::...|..:| ::.|:..:|.:|..|.....|..|: |.:.:...::|.:::    |....|.
plant     4 WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIIAL-RSNVSAIDVVELVIRELETDPLFNSG 67

  Fly   533 KES--MEKEHIEFQPSLTPAHSYFNRILLQVSRSDGAKMKITIPDHMKVDHSARNLDPFVLETTE 595
            :.|  .||..:|.:.|:                .||.|.:......:....:..:|...|::.:.
plant    68 RGSALTEKGTVEMEASI----------------MDGTKRRCGAVSGITTVKNPISLARLVMDKSP 116

  Fly   596 LSQYLSQHGLKLRVEELACQEDIQ-----------NVGIFR 625
            .| ||:..|    .|:.|.::.::           |||:.:
plant   117 HS-YLAFSG----AEDFARKQGVEIVDNEYFVTDDNVGMLK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
ASPGB1NP_566536.1 PLN02689 1..325 CDD:215372 31/171 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.