DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and ASRGL1

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_079356.3 Gene:ASRGL1 / 80150 HGNCID:16448 Length:308 Species:Homo sapiens


Alignment Length:97 Identity:24/97 - (24%)
Similarity:42/97 - (43%) Gaps:16/97 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 LNDN-EIPLD-SLSSLQTFEEGTMDPLNI---PLDLPRRNLEKILNPEGSDRASDQVASDINDEP 766
            ||.| |:.:| |:...:....|.:..:..   |:.|.|..:||..:...:|:.:.|.|:.:. .|
Human    69 LNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMG-VP 132

  Fly   767 PSPETLLLQVSNFDCWLLHGYMKRIRRHDKHE 798
            ..|...|:...|         .||:.: :|||
Human   133 EIPGEKLVTERN---------KKRLEK-EKHE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
ASRGL1NP_079356.3 ASRGL1_like 2..291 CDD:271338 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.