DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and Tasp1

DIOPT Version :9

Sequence 1:NP_001262451.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:XP_011238131.1 Gene:Tasp1 / 75812 MGIID:1923062 Length:443 Species:Mus musculus


Alignment Length:166 Identity:34/166 - (20%)
Similarity:59/166 - (35%) Gaps:53/166 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NMGAKPELKLM-TLQVWAAYLDSMEVAFSKSNKTGLPKLNVRALP-IDARIIYNHKTFKKGKKGK 161
            |.|....|.|: .::..|:.:|...:.|..          |.||. |...:...|:...:|:|||
Mouse   123 NAGIGSNLNLLGEIECDASIMDGKSLNFGA----------VGALSGIKNPVSVAHRLLCEGQKGK 177

  Fly   162 KST-------LTGD---------------PNDERAKFRL--WNRTKRNLDASGYRSHGGASESEG 202
            .|.       |.|:               |:....:|.|  :.|.||.|:.           :|.
Mouse   178 LSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLEL-----------AER 231

  Fly   203 EQSLHLQWSMRARKSLKRHMPLKHLDKHSRDSKGSM 238
            .::..:|...|.:.|.|.:      |..:.|:.|::
Mouse   232 VETDFIQLKRRRQSSAKEN------DSGTLDTVGAV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_001262451.1 RRN7 8..40 CDD:288614
Tasp1XP_011238131.1 Taspase1_like 42..439 CDD:271336 34/166 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.