DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and tasp1

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:XP_073775918.1 Gene:tasp1 / 566980 ZFINID:ZDB-GENE-070424-242 Length:475 Species:Danio rerio


Alignment Length:51 Identity:16/51 - (31%)
Similarity:27/51 - (52%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KKGKKSTLTGDPNDERAKFRLWNR--TKRNLDASGYRSHGGASES-EGEQS 205
            |...|.:|:|...::| |..|..:  |||.:.:.|:.:..|..|. |||::
Zfish   181 KMTTKFSLSGYKRNKR-KMELAEQVETKRRIQSCGHENDFGCLEPVEGEEN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
tasp1XP_073775918.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.