DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and aga

DIOPT Version :9

Sequence 1:NP_001262451.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001103751.1 Gene:aga / 566517 ZFINID:ZDB-GENE-040426-2311 Length:337 Species:Danio rerio


Alignment Length:219 Identity:43/219 - (19%)
Similarity:71/219 - (32%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 GSAAMKRQHENLTHII---ETMLKDHFGESSKESMEKEHIE-----FQPSLTPAHSYFNRILLQV 561
            |.|....:|...|.|:   .|:...:.|.:|::....:.|.     .|.:..|  :|...:....
Zfish   105 GVARAVMEHSEHTFIVGESATIFAQNMGFTSEDLSTNKSIAIFSQWLQQNCQP--NYRKNVSPDP 167

  Fly   562 SRSDG-----AKMKITIPDHMKVDHSARNLDPFVLETT---------ELSQYLSQHGLKLRVEEL 612
            |:|.|     ||..::       .|...|.||...:|.         :::...|.:|...::...
Zfish   168 SKSCGPYKPKAKQWMS-------KHPRGNFDPRSHDTIGMVVIGRQGQVAAATSTNGATHKIPGR 225

  Fly   613 ACQEDIQNVGIFRPLTI----IRGDG---------------REYRANTEIKTETWISELKRKEKR 658
            .....:...|.:...|:    ..|||               ....|...:...|.|:.:|:  ..
Zfish   226 VGDSPVAGAGAYADSTVGGAAATGDGDIMMRFLPSFLAVELMRNGAQPTVACRTAINRIKK--YY 288

  Fly   659 PDFRF-----TQPTGTYGARYLKR 677
            ||| |     ....|.|||...||
Zfish   289 PDF-FGAVICANTAGDYGAACNKR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_001262451.1 RRN7 8..40 CDD:288614
agaNP_001103751.1 Glycosylasparaginase 21..323 CDD:271335 43/219 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.