DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and asrgl1

DIOPT Version :9

Sequence 1:NP_001262451.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001013547.1 Gene:asrgl1 / 541402 ZFINID:ZDB-GENE-050320-102 Length:310 Species:Danio rerio


Alignment Length:76 Identity:18/76 - (23%)
Similarity:25/76 - (32%) Gaps:32/76 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 VIVSHYNQSFARRFGVSTRTGCQVDDILAKEWKEKEQGET-FGWMQGSAAMKRQHENLTHIIETM 523
            |:|..:|.::|.||           ..|...|...:||:. ||...|                  
Zfish   264 VVVVDHNGTWAARF-----------SSLQMSWAAAQQGKLHFGLFHG------------------ 299

  Fly   524 LKDHFGESSKE 534
              |||.|..:|
Zfish   300 --DHFTEPVEE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_001262451.1 RRN7 8..40 CDD:288614
asrgl1NP_001013547.1 ASRGL1_like 3..290 CDD:271338 8/36 (22%)
Substrate binding. /evidence=ECO:0000250 195..198
Substrate binding. /evidence=ECO:0000250 218..221
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.