powered by:
Protein Alignment TAF1B and asrgl1
DIOPT Version :9
Sequence 1: | NP_001262451.1 |
Gene: | TAF1B / 41242 |
FlyBaseID: | FBgn0037792 |
Length: | 872 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013547.1 |
Gene: | asrgl1 / 541402 |
ZFINID: | ZDB-GENE-050320-102 |
Length: | 310 |
Species: | Danio rerio |
Alignment Length: | 76 |
Identity: | 18/76 - (23%) |
Similarity: | 25/76 - (32%) |
Gaps: | 32/76 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 460 VIVSHYNQSFARRFGVSTRTGCQVDDILAKEWKEKEQGET-FGWMQGSAAMKRQHENLTHIIETM 523
|:|..:|.::|.|| ..|...|...:||:. ||...|
Zfish 264 VVVVDHNGTWAARF-----------SSLQMSWAAAQQGKLHFGLFHG------------------ 299
Fly 524 LKDHFGESSKE 534
|||.|..:|
Zfish 300 --DHFTEPVEE 308
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1446 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.