DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and Tasp1

DIOPT Version :9

Sequence 1:NP_001262451.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster


Alignment Length:102 Identity:21/102 - (20%)
Similarity:41/102 - (40%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 HFGESSKESMEKEHIEFQPSLTPAHS---YFNRILLQVSRSDGAKMKITIPDHMKVDHSARNLDP 588
            :||..:..|..|..|:....:..|.|   ...||...:....||       :|...:.....::|
  Fly    85 NFGACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGA-------EHYADEVGCSMVEP 142

  Fly   589 FVLETT----ELSQYLSQHGLKL--RVEELACQEDIQ 619
            .||.::    :.:.|.|::.|.:  |:.:...:|.:|
  Fly   143 GVLISSKAKFQFNHYKSKYDLVVNSRLGKATSEESVQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_001262451.1 RRN7 8..40 CDD:288614
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 21/102 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.