DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and CG10474

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster


Alignment Length:174 Identity:35/174 - (20%)
Similarity:59/174 - (33%) Gaps:61/174 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   565 DGAKMKITIPDHMKVDHSARNLDPFVLETTELSQYLSQHGLKLRVEELACQEDIQNVGIFRPLTI 629
            ||..|::.....::...||          .:::|::.:|.|.                     |:
  Fly    69 DGGTMEVGAVGDLRRIRSA----------IKVAQHVLEHTLH---------------------TL 102

  Fly   630 IRGDGREYRANT------EIKTETWISELK---RKEKRPDF-RFTQP-TGTYGARYLKRITMRDA 683
            :.|||.:..||.      .:.:|..|..||   |...:|:| |...| ..|....|...:|    
  Fly   103 LVGDGADEFANAMGLQYESLNSEDNIESLKNWTRHNCQPNFWRNVHPDPRTSCGPYQPLVT---- 163

  Fly   684 RRVQLEINNPFWDVTETPSFLLKLN-DNEIPLDSLSSLQTFEEG 726
                       ||.....|..:::. ||.   |:::.....|||
  Fly   164 -----------WDPNAKQSDRIEIGPDNH---DTITMAAIDEEG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 35/174 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.