DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and Tasp1

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:XP_017447248.1 Gene:Tasp1 / 311468 RGDID:1308591 Length:438 Species:Rattus norvegicus


Alignment Length:182 Identity:36/182 - (19%)
Similarity:66/182 - (36%) Gaps:59/182 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VLRGFLQELL------NMGAKPELKLM-TLQVWAAYLDSMEVAFSKSNKTGLPKLNVRALP-IDA 145
            :|..:|..::      |.|....|.|: .::..|:.:|...::|..          |.||. |..
  Rat   102 LLEAYLVSIVLDSPFTNAGVGSNLNLLGEIECDASIMDGKSLSFGA----------VGALSGIKN 156

  Fly   146 RIIYNHKTFKKGKKGKKST-------LTGD---------------PNDERAKFRL--WNRTKRNL 186
            .:...|:...:|:|||.|.       |.|:               |:....:|.|  :.|.||.|
  Rat   157 PVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKL 221

  Fly   187 DASGYRSHGGASESEGEQSLHLQWSMRARKSLKRHMPLKHLDKHSRDSKGSM 238
            :.           :|..::..:|...|.:.|.|.:      |..:.|:.|::
  Rat   222 EL-----------AERVETDFIQLKRRRQSSAKEN------DSGALDTVGAV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
Tasp1XP_017447248.1 Taspase1_like 42..434 CDD:271336 36/182 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.