DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and tasp-1

DIOPT Version :10

Sequence 1:NP_649982.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001379234.1 Gene:tasp-1 / 176508 WormBaseID:WBGene00010480 Length:331 Species:Caenorhabditis elegans


Alignment Length:102 Identity:25/102 - (24%)
Similarity:45/102 - (44%) Gaps:29/102 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 NIIKLYVVLGIALNMVEDD--IQLSDLLR-FIDE--EHLTKRCMLNYLPGNVAAKGKALLKDMEL 320
            :::|.....|||..:::|:  |..|:::| ||.|  ||.::            ..|.||:.|   
 Worm   227 SLVKADFCRGIATRVLDDEEGIMYSEIIREFIHEKMEHGSR------------YGGIALIAD--- 276

  Fly   321 SKMKDKVTNKLLRVN--------IACMSRFINLSEYQ 349
             |.||:::.:.|..:        :.|....|.:.|.|
 Worm   277 -KFKDRMSLEFLIFHNCRYLPAAVRCRDNQIRVFESQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_649982.1 zf-RRN7 12..40 CDD:463348
tasp-1NP_001379234.1 Taspase1_like 5..304 CDD:271336 22/92 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.