DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF1B and AGA

DIOPT Version :9

Sequence 1:NP_001262451.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_000018.2 Gene:AGA / 175 HGNCID:318 Length:346 Species:Homo sapiens


Alignment Length:199 Identity:41/199 - (20%)
Similarity:69/199 - (34%) Gaps:44/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 LTHIIETMLKDHFGESSKESMEKEHIEFQPSLTPA-HS----------YFNRILLQVSRSDG--- 566
            |.|...|:|......:..:||...:.:...:.:.| ||          |:..::...|:..|   
Human   119 LEHTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYK 183

  Fly   567 --AKMKITIPDHMKVDHSARNLDPF----VLETTELSQYLSQHGLKLRVEELACQEDIQNVGIFR 625
              ..:|..||.|.:.:.. |..|..    :.:|..::...|.:|:|.::........|...|.:.
Human   184 PPGILKQDIPIHKETEDD-RGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYA 247

  Fly   626 PLT----IIRGDGR------------EYRANTEIKTETWISELKRKEKR-PDFRF-----TQPTG 668
            ..|    ...|:|.            ||....|..|......:.|.:|. |:| |     ...||
Human   248 DDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEF-FGAVICANVTG 311

  Fly   669 TYGA 672
            :|||
Human   312 SYGA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF1BNP_001262451.1 RRN7 8..40 CDD:288614
AGANP_000018.2 Glycosylasparaginase 29..332 CDD:271335 41/199 (21%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 234..237 0/2 (0%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 257..260 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.