DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TAF1B and Aga

DIOPT Version :9

Sequence 1:	NP_001262451.1	Gene:	TAF1B / 41242	FlyBaseID:	FBgn0037792	Length:	872	Species:	Drosophila melanogaster
Sequence 2:	NP_001005847.1	Gene:	Aga / 11593	MGIID:	104873	Length:	346	Species:	Mus musculus

Alignment Length:	123	Identity:	22/123 - (17%)
Similarity:	40/123 - (32%)	Gaps:	50/123 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   145 ARIIYNHKTFKKGKKGKKSTLTGDPNDERAKFRLWNRTKRNLDASGYRSHGGASESEGEQSLHLQ 209
            ||.:..|.|        .:.|.|   |...||         .::.|:.:...::::  .:.||..
Mouse   115 ARRVLEHTT--------HTLLVG---DSATKF---------AESMGFTNEDLSTKT--SRDLHSD 157

  Fly   210 WSMR--------------------------ARKSLKRHMPLKHLDKHSRDSKGSMSCH 241
            |..|                          .::|:..|.  :.:|.||.|:.|.:..|
Mouse   158 WLSRNCQPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHK--EEVDIHSHDTIGMVVIH 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TAF1B	NP_001262451.1	RRN7	8..40	CDD:288614
Aga	NP_001005847.1	Glycosylasparaginase	29..332	CDD:271335	22/123 (18%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:P20933	234..237
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:P20933	257..260
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1446
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900